SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30147.Seq
         (878 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha ...   202   3e-52
At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha ...   202   3e-52
At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha ...   202   3e-52
At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha ...   202   3e-52
At1g18070.1 68414.m02236 EF-1-alpha-related GTP-binding protein,...   113   1e-25
At5g10630.1 68418.m01231 elongation factor 1-alpha, putative / E...   108   4e-24
At4g20360.1 68417.m02971 elongation factor Tu / EF-Tu (TUFA) ide...    68   7e-12
At4g02930.1 68417.m00399 elongation factor Tu, putative / EF-Tu,...    66   4e-11
At4g18330.2 68417.m02719 eukaryotic translation initiation facto...    41   0.001
At4g18330.1 68417.m02718 eukaryotic translation initiation facto...    41   0.001
At1g04170.1 68414.m00407 eukaryotic translation initiation facto...    38   0.007
At2g18720.1 68415.m02180 eukaryotic translation initiation facto...    38   0.009
At1g06220.2 68414.m00656 elongation factor Tu family protein sim...    36   0.036
At1g06220.1 68414.m00655 elongation factor Tu family protein sim...    36   0.036
At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-...    34   0.11 
At4g11160.1 68417.m01808 translation initiation factor IF-2, mit...    33   0.33 
At3g22980.1 68416.m02898 elongation factor Tu family protein sim...    33   0.33 
At1g62750.1 68414.m07082 elongation factor Tu family protein sim...    33   0.33 
At2g45030.1 68415.m05606 mitochondrial elongation factor, putati...    31   0.77 
At1g76720.1 68414.m08929 eukaryotic translation initiation facto...    31   0.77 
At1g45332.1 68414.m05195 mitochondrial elongation factor, putati...    31   0.77 
At1g21160.1 68414.m02646 eukaryotic translation initiation facto...    31   0.77 
At5g08650.1 68418.m01029 GTP-binding protein LepA, putative            31   1.3  
At1g76825.1 68414.m08940 eukaryotic translation initiation facto...    31   1.3  
At1g76810.1 68414.m08938 eukaryotic translation initiation facto...    31   1.3  
At1g56070.1 68414.m06438 elongation factor 2, putative / EF-2, p...    29   3.1  
At1g12570.1 68414.m01459 glucose-methanol-choline (GMC) oxidored...    29   3.1  
At5g35980.1 68418.m04333 protein kinase family protein contains ...    29   4.1  
At2g46830.1 68415.m05843 myb-related transcription factor (CCA1)...    29   5.4  
At1g47840.1 68414.m05325 hexokinase, putative similar to hexokin...    29   5.4  
At5g04540.1 68418.m00454 expressed protein                             28   7.2  
At3g10550.1 68416.m01266 expressed protein                             28   7.2  
At2g43510.1 68415.m05406 trypsin inhibitor, putative similar to ...    28   7.2  
At1g17220.1 68414.m02098 translation initiation factor IF-2, chl...    28   7.2  
At5g26570.1 68418.m03152 glycoside hydrolase starch-binding doma...    28   9.5  
At1g62660.1 68414.m07071 beta-fructosidase (BFRUCT3) / beta-fruc...    28   9.5  

>At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha
           identical to SWISS-PROT:P13905 elongation factor 1-alpha
           (EF-1-alpha) [Arabidopsis thaliana]
          Length = 449

 Score =  202 bits (492), Expect = 3e-52
 Identities = 105/195 (53%), Positives = 127/195 (65%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQ
Sbjct: 73  IDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQ+I   NKMD+           +  ++     +++GYNP  + FVP
Sbjct: 133 TREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISG+ GDNM+E ST + W+K            G  L+EALD I  P RP   P   P + 
Sbjct: 193 ISGFEGDNMIERSTNLDWYK------------GPTLLEALDQINEPKRPSDKPLRLPLQD 240

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 241 VYKIGGIGTVPVGRV 255



 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/68 (89%), Positives = 62/68 (91%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score =  202 bits (492), Expect = 3e-52
 Identities = 105/195 (53%), Positives = 127/195 (65%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQ
Sbjct: 73  IDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQ+I   NKMD+           +  ++     +++GYNP  + FVP
Sbjct: 133 TREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISG+ GDNM+E ST + W+K            G  L+EALD I  P RP   P   P + 
Sbjct: 193 ISGFEGDNMIERSTNLDWYK------------GPTLLEALDQINEPKRPSDKPLRLPLQD 240

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 241 VYKIGGIGTVPVGRV 255



 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/68 (89%), Positives = 62/68 (91%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score =  202 bits (492), Expect = 3e-52
 Identities = 105/195 (53%), Positives = 127/195 (65%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQ
Sbjct: 73  IDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQ+I   NKMD+           +  ++     +++GYNP  + FVP
Sbjct: 133 TREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISG+ GDNM+E ST + W+K            G  L+EALD I  P RP   P   P + 
Sbjct: 193 ISGFEGDNMIERSTNLDWYK------------GPTLLEALDQINEPKRPSDKPLRLPLQD 240

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 241 VYKIGGIGTVPVGRV 255



 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/68 (89%), Positives = 62/68 (91%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score =  202 bits (492), Expect = 3e-52
 Identities = 105/195 (53%), Positives = 127/195 (65%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQ
Sbjct: 73  IDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQ+I   NKMD+           +  ++     +++GYNP  + FVP
Sbjct: 133 TREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISG+ GDNM+E ST + W+K            G  L+EALD I  P RP   P   P + 
Sbjct: 193 ISGFEGDNMIERSTNLDWYK------------GPTLLEALDQINEPKRPSDKPLRLPLQD 240

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 241 VYKIGGIGTVPVGRV 255



 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/68 (89%), Positives = 62/68 (91%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>At1g18070.1 68414.m02236 EF-1-alpha-related GTP-binding protein,
           putative similar to EF-1-alpha-related GTP-binding
           protein gi|1009232|gb|AAA79032
          Length = 532

 Score =  113 bits (273), Expect = 1e-25
 Identities = 62/144 (43%), Positives = 83/144 (57%), Gaps = 3/144 (2%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FET     TI+DAPGH+ ++ NMI+G SQAD  VL+++A  GEFE G  + GQ
Sbjct: 167 VEVGRAHFETESTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGYERGGQ 226

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA-VAFV 612
           TREH  LA TLGV +LIV VNKMD    +       +  +K     +  GYN    V F+
Sbjct: 227 TREHVQLAKTLGVSKLIVVVNKMDDPTVNWSKERYDEIEQKMVPFLKASGYNTKKDVVFL 286

Query: 613 PISGWHGDNMLEPSTK--MPWFKG 678
           PISG  G NM +   +   PW+ G
Sbjct: 287 PISGLMGKNMDQRMGQEICPWWSG 310



 Score = 68.1 bits (159), Expect = 7e-12
 Identities = 28/64 (43%), Positives = 46/64 (71%)
 Frame = +3

Query: 51  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 230
           +K H+N+V IGHVD+GKST  G +++  G +D R I+K+EKEA++  + S+  A+++D  
Sbjct: 98  KKRHLNVVFIGHVDAGKSTIGGQILFLSGQVDDRQIQKYEKEAKDKSRESWYMAYIMDTN 157

Query: 231 KAER 242
           + ER
Sbjct: 158 EEER 161


>At5g10630.1 68418.m01231 elongation factor 1-alpha, putative /
           EF-1-alpha, putative contains similarity to
           SWISS-PROT:Q9YAV0 elongation factor 1-alpha (EF-1-alpha)
           [Aeropyrum pernix]
          Length = 667

 Score =  108 bits (260), Expect = 4e-24
 Identities = 60/177 (33%), Positives = 98/177 (55%), Gaps = 2/177 (1%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK-NGQT 438
           +A+  F + +++V ++D+PGH+DF+ NMI G +QAD A+L++ A  G FEAG     GQT
Sbjct: 307 VAVAYFNSKRHHVVLLDSPGHKDFVPNMIAGATQADAAILVIDASVGAFEAGFDNLKGQT 366

Query: 439 REHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPI 618
           REHA +    GV+Q+IV +NKMD + +     DL K        S R  +  +++ ++P+
Sbjct: 367 REHARVLRGFGVEQVIVAINKMDIVGYSKERFDLIKQHVGSFLQSCR--FKDSSLTWIPL 424

Query: 619 SGWHGDNML-EPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFP 786
           S     N++  PS        W          G CL++A+D++  P R ++ P + P
Sbjct: 425 SAMENQNLVAAPSDNR--LSSWY--------QGPCLLDAVDSVKSPDRDVSKPLLMP 471



 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 32/63 (50%), Positives = 46/63 (73%)
 Frame = +3

Query: 57  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 236
           + +N+ ++GHVDSGKST +G L++  G I ++ + K+EKEA+  GKGSF YAW LD+   
Sbjct: 238 SQLNLAIVGHVDSGKSTLSGRLLHLLGRISQKQMHKYEKEAKLQGKGSFAYAWALDESAE 297

Query: 237 ERE 245
           ERE
Sbjct: 298 ERE 300


>At4g20360.1 68417.m02971 elongation factor Tu / EF-Tu (TUFA)
           identical to SWISS-PROT:P17745 elongation factor Tu,
           chloroplast precursor (EF-Tu) [Arabidopsis thaliana]
          Length = 476

 Score = 68.1 bits (159), Expect = 7e-12
 Identities = 34/87 (39%), Positives = 52/87 (59%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I+ A  ++ET   +   +D PGH D++KNMITG +Q D A+L+V+   G          Q
Sbjct: 130 INTATVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGADGPMP-------Q 182

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLN 516
           T+EH LLA  +GV  ++V +NK D ++
Sbjct: 183 TKEHILLAKQVGVPDMVVFLNKEDQVD 209



 Score = 39.1 bits (87), Expect = 0.004
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +3

Query: 39  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK 173
           K  ++K H+NI  IGHVD GK+T T  L      I     +K+++
Sbjct: 72  KFERKKPHVNIGTIGHVDHGKTTLTAALTMALASIGSSVAKKYDE 116


>At4g02930.1 68417.m00399 elongation factor Tu, putative / EF-Tu,
           putative similar to mitochondrial elongation factor Tu
           [Arabidopsis thaliana] gi|1149571|emb|CAA61511
          Length = 454

 Score = 65.7 bits (153), Expect = 4e-11
 Identities = 32/78 (41%), Positives = 48/78 (61%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 453
           ++ET+K +   +D PGH D++KNMITG +Q D  +L+V+   G          QT+EH L
Sbjct: 124 EYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSGPDGPMP-------QTKEHIL 176

Query: 454 LAFTLGVKQLIVGVNKMD 507
           LA  +GV  L+  +NK+D
Sbjct: 177 LARQVGVPSLVCFLNKVD 194



 Score = 32.7 bits (71), Expect = 0.33
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTT 113
           + K H+N+  IGHVD GK+T T
Sbjct: 63  RNKPHVNVGTIGHVDHGKTTLT 84


>At4g18330.2 68417.m02719 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative similar to SP|Q09130 Eukaryotic translation
           initiation factor 2 gamma subunit (eIF-2- gamma)
           {Schizosaccharomyces pombe}; contains Pfam profile
           PF00009: Elongation factor Tu GTP binding domain;
           isoform predicted to contain a TG non-consensus acceptor
           splice site.
          Length = 471

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 23/78 (29%), Positives = 39/78 (50%)
 Frame = +1

Query: 283 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAF 462
           T + +V+ +D PGH   +  M+ G +  D A+L++AA             QT EH     
Sbjct: 124 TLRRHVSCVDCPGHDILMATMLNGAAIVDGALLLIAANES------CPQPQTAEHLASVD 177

Query: 463 TLGVKQLIVGVNKMDSLN 516
            + +K +I+  NK+D +N
Sbjct: 178 MMRLKHIIILQNKIDLIN 195


>At4g18330.1 68417.m02718 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative similar to SP|Q09130 Eukaryotic translation
           initiation factor 2 gamma subunit (eIF-2- gamma)
           {Schizosaccharomyces pombe}; contains Pfam profile
           PF00009: Elongation factor Tu GTP binding domain;
           isoform predicted to contain a TG non-consensus acceptor
           splice site.
          Length = 284

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 23/78 (29%), Positives = 39/78 (50%)
 Frame = +1

Query: 283 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAF 462
           T + +V+ +D PGH   +  M+ G +  D A+L++AA             QT EH     
Sbjct: 124 TLRRHVSCVDCPGHDILMATMLNGAAIVDGALLLIAANES------CPQPQTAEHLASVD 177

Query: 463 TLGVKQLIVGVNKMDSLN 516
            + +K +I+  NK+D +N
Sbjct: 178 MMRLKHIIILQNKIDLIN 195


>At1g04170.1 68414.m00407 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative similar to gb|U37354 from S. pombe. ESTs
           gb|T41979, gb|N37284 and gb|N37529 come from this gene
          Length = 465

 Score = 38.3 bits (85), Expect = 0.007
 Identities = 25/86 (29%), Positives = 41/86 (47%), Gaps = 4/86 (4%)
 Frame = +1

Query: 277 FETSKY----YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 444
           FE SK     +V+ +D PGH   +  M+ G +  D A+L++AA             QT E
Sbjct: 112 FENSKMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANE------TCPQPQTSE 165

Query: 445 HALLAFTLGVKQLIVGVNKMDSLNHH 522
           H      + +K +I+  NK+D +  +
Sbjct: 166 HLAAVEIMQLKHIIILQNKIDLIQEN 191


>At2g18720.1 68415.m02180 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative 
          Length = 465

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 22/76 (28%), Positives = 37/76 (48%)
 Frame = +1

Query: 295 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 474
           +V+ +D PGH   +  M+ G +  D A+LI+AA             QT EH      + +
Sbjct: 120 HVSFVDCPGHDILMATMLNGAAIMDGALLIIAANE------TCPQPQTAEHLASVDMMHL 173

Query: 475 KQLIVGVNKMDSLNHH 522
           K +I+  NK+D +  +
Sbjct: 174 KDIIIIQNKIDLIQEN 189


>At1g06220.2 68414.m00656 elongation factor Tu family protein
           similar to Cryptosporidium parvum elongation factor-2
           GB:U21667 GI:706974 from [Cryptosporidium parvum]
          Length = 987

 Score = 35.9 bits (79), Expect = 0.036
 Identities = 19/56 (33%), Positives = 26/56 (46%)
 Frame = +1

Query: 235 LSVXRYQIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           +S+    + + L    +  Y   I+D PGH +F   M      AD AVLIV A  G
Sbjct: 190 ISIKAVPMSLVLEDSRSKSYLCNIMDTPGHVNFSDEMTASLRLADGAVLIVDAAEG 245


>At1g06220.1 68414.m00655 elongation factor Tu family protein
           similar to Cryptosporidium parvum elongation factor-2
           GB:U21667 GI:706974 from [Cryptosporidium parvum]
          Length = 987

 Score = 35.9 bits (79), Expect = 0.036
 Identities = 19/56 (33%), Positives = 26/56 (46%)
 Frame = +1

Query: 235 LSVXRYQIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           +S+    + + L    +  Y   I+D PGH +F   M      AD AVLIV A  G
Sbjct: 190 ISIKAVPMSLVLEDSRSKSYLCNIMDTPGHVNFSDEMTASLRLADGAVLIVDAAEG 245


>At5g39900.1 68418.m04839 GTP-binding protein LepA, putative
           GTP-binding protein GUF1 - Saccharomyces cerevisiae,
           PIR:S50374
          Length = 661

 Score = 34.3 bits (75), Expect = 0.11
 Identities = 28/93 (30%), Positives = 42/93 (45%)
 Frame = +1

Query: 280 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 459
           E S Y + +ID PGH DF   +    S    A+L+V A  G          QT  +  LA
Sbjct: 131 EASGYLLNLIDTPGHVDFSYEVSRSLSACQGALLVVDAAQG-------VQAQTVANFYLA 183

Query: 460 FTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRK 558
           F   +  ++  +NK+D     T  P+  K++ K
Sbjct: 184 FEANL-TIVPVINKID---QPTADPERVKAQLK 212



 Score = 27.9 bits (59), Expect = 9.5
 Identities = 16/40 (40%), Positives = 19/40 (47%)
 Frame = +3

Query: 30  D*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDK 149
           D  K   EK   N  +I H+D GKST    L+   G I K
Sbjct: 57  DLTKFPSEKIR-NFSIIAHIDHGKSTLADRLMELTGTIKK 95


>At4g11160.1 68417.m01808 translation initiation factor IF-2,
           mitochondrial, putative similar to SP|P46198|IF2M_BOVIN
           Translation initiation factor IF-2, mitochondrial
           precursor (IF-2Mt) (IF-2(Mt)) {Bos taurus}
          Length = 743

 Score = 32.7 bits (71), Expect = 0.33
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           +T +D PGH  F +    G +  D  VL+VAA  G
Sbjct: 270 ITFLDTPGHAAFSEMRARGAAVTDIVVLVVAADDG 304


>At3g22980.1 68416.m02898 elongation factor Tu family protein
           similar to eukaryotic translation elongation factor 2
           GB:NP_001952 [Homo sapiens]
          Length = 1015

 Score = 32.7 bits (71), Expect = 0.33
 Identities = 13/25 (52%), Positives = 16/25 (64%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCGG 140
           NI ++ HVD GK+T   HLI   GG
Sbjct: 11  NICILAHVDHGKTTLADHLIASSGG 35



 Score = 32.7 bits (71), Expect = 0.33
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = +1

Query: 292 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           Y + +ID+PGH DF   + T    +D A+++V A  G
Sbjct: 74  YSLNLIDSPGHMDFCSEVSTAARLSDGALVLVDAVEG 110


>At1g62750.1 68414.m07082 elongation factor Tu family protein
           similar to elongation factor G SP:P34811 [Glycine max
           (Soybean)]
          Length = 783

 Score = 32.7 bits (71), Expect = 0.33
 Identities = 12/28 (42%), Positives = 20/28 (71%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCG 137
           K + NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 94  KDYRNIGIMAHIDAGKTTTTERILYYTG 121


>At2g45030.1 68415.m05606 mitochondrial elongation factor, putative
           similar to SP|P25039 Elongation factor G 1,
           mitochondrial precursor (mEF-G-1) {Saccharomyces
           cerevisiae}; contains Pfam profiles PF00009: Elongation
           factor Tu GTP binding domain, PF03764: Elongation factor
           G domain IV, PF00679: Elongation factor G C-terminus
          Length = 754

 Score = 31.5 bits (68), Expect = 0.77
 Identities = 17/52 (32%), Positives = 25/52 (48%)
 Frame = +1

Query: 292 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREH 447
           Y V IID PGH DF   +       D A+L++ +  G     I+ + Q R +
Sbjct: 133 YKVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSITVDRQMRRY 184



 Score = 27.9 bits (59), Expect = 9.5
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCGGI 143
           NI +  H+DSGK+T T  +++  G I
Sbjct: 67  NIGISAHIDSGKTTLTERVLFYTGRI 92


>At1g76720.1 68414.m08929 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to
           SP|O60841 Translation initiation factor IF-2 {Homo
           sapiens}; contains Pfam profiles PF00009: Elongation
           factor Tu GTP binding domain, PF03144: Elongation factor
           Tu domain 2
          Length = 1201

 Score = 31.5 bits (68), Expect = 0.77
 Identities = 22/70 (31%), Positives = 35/70 (50%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           +ID PGH  F      G+S  D A+L+V     + + G+    QT E +L    +   + 
Sbjct: 705 VIDTPGHESFTNLRSRGSSLCDLAILVV-----DIKHGLEP--QTIE-SLNLLRMRNTEF 756

Query: 484 IVGVNKMDSL 513
           I+ +NK+D L
Sbjct: 757 IIALNKVDRL 766


>At1g45332.1 68414.m05195 mitochondrial elongation factor, putative
           similar to mitochondrial elongation factor GI:3917 from
           [Saccharomyces cerevisiae]
          Length = 754

 Score = 31.5 bits (68), Expect = 0.77
 Identities = 17/52 (32%), Positives = 25/52 (48%)
 Frame = +1

Query: 292 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREH 447
           Y V IID PGH DF   +       D A+L++ +  G     I+ + Q R +
Sbjct: 133 YKVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSITVDRQMRRY 184



 Score = 27.9 bits (59), Expect = 9.5
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCGGI 143
           NI +  H+DSGK+T T  +++  G I
Sbjct: 67  NIGISAHIDSGKTTLTERVLFYTGRI 92


>At1g21160.1 68414.m02646 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to
           SP|O60841 Translation initiation factor IF-2 {Homo
           sapiens}; contains Pfam profiles PF00009: Elongation
           factor Tu GTP binding domain, PF03144: Elongation factor
           Tu domain 2
          Length = 1088

 Score = 31.5 bits (68), Expect = 0.77
 Identities = 23/72 (31%), Positives = 34/72 (47%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           + +ID PGH  F      G++  D A+L+V     +   G+    QT E   L     VK
Sbjct: 558 ILVIDTPGHESFTNLRSRGSNLCDLAILVV-----DIMRGLEP--QTIESLNLLRRRNVK 610

Query: 478 QLIVGVNKMDSL 513
             I+ +NK+D L
Sbjct: 611 -FIIALNKVDRL 621


>At5g08650.1 68418.m01029 GTP-binding protein LepA, putative
          Length = 681

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 13/42 (30%), Positives = 23/42 (54%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           +E + + + +ID PGH DF   +    +  + A+L+V A  G
Sbjct: 147 YEDTPFCLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQG 188



 Score = 28.3 bits (60), Expect = 7.2
 Identities = 11/33 (33%), Positives = 18/33 (54%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEK 164
           N  +I H+D GKST    L+   G +  R +++
Sbjct: 88  NFSIIAHIDHGKSTLADKLLQVTGTVQNRDMKE 120


>At1g76825.1 68414.m08940 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to
           SP|O60841 Translation initiation factor IF-2 {Homo
           sapiens}; contains Pfam profile PF00009: Elongation
           factor Tu GTP binding domain
          Length = 630

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 22/70 (31%), Positives = 34/70 (48%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           +ID PGH  F      G+S  D A+L+V     +   G+    QT E +L    +   + 
Sbjct: 113 VIDTPGHESFTNLRSRGSSLCDLAILVV-----DITHGLQP--QTIE-SLNLLRMRNTEF 164

Query: 484 IVGVNKMDSL 513
           I+ +NK+D L
Sbjct: 165 IIALNKVDRL 174


>At1g76810.1 68414.m08938 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to IF2
           protein [Drosophila melanogaster] GI:7108770; contains
           Pfam profile PF03144: Elongation factor Tu domain 2
          Length = 1294

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 23/70 (32%), Positives = 34/70 (48%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           +ID PGH  F      G+S  D A+L+V     +   G+    QT E +L    +   + 
Sbjct: 772 VIDTPGHESFTNLRSRGSSLCDLAILVV-----DIMHGLEP--QTIE-SLNLLRMRNTEF 823

Query: 484 IVGVNKMDSL 513
           IV +NK+D L
Sbjct: 824 IVALNKVDRL 833


>At1g56070.1 68414.m06438 elongation factor 2, putative / EF-2,
           putative similar to ELONGATION FACTOR 2 GB:O14460 from
           [Schizosaccharomyces pombe]
          Length = 843

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 11/34 (32%), Positives = 20/34 (58%)
 Frame = +1

Query: 286 SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 387
           ++Y + +ID+PGH DF   +       D A+++V
Sbjct: 96  NEYLINLIDSPGHVDFSSEVTAALRITDGALVVV 129



 Score = 29.1 bits (62), Expect = 4.1
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCG 137
           N+ VI HVD GKST T  L+   G
Sbjct: 21  NMSVIAHVDHGKSTLTDSLVAAAG 44


>At1g12570.1 68414.m01459 glucose-methanol-choline (GMC)
           oxidoreductase family protein similar to mandelonitrile
           lyase from Prunus serotina [SP|P52706, SP|P52707];
           contains Pfam profile PF00732 GMC oxidoreductase
          Length = 572

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 29/118 (24%), Positives = 47/118 (39%), Gaps = 2/118 (1%)
 Frame = +1

Query: 268 LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREH 447
           L ++   K    ++ A  HR   +    GT++     ++    TG+      K G   E 
Sbjct: 216 LLEYADPKGITVLLHATVHRILFRTR--GTTKPIANGVVYRDRTGQAHRAYLKEGALSEI 273

Query: 448 ALLAFTLGVKQLIV--GVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
            L A TLG  QL++  GV     L    ++  + +     PH  + +  NP    FVP
Sbjct: 274 ILSAGTLGSPQLLMLSGVGPSAQLQAQNITVVMDQ-----PHVGQGMYDNPMNAVFVP 326


>At5g35980.1 68418.m04333 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 956

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 2/52 (3%)
 Frame = +1

Query: 529 SPDLRKSRRKYPHTS--RRLGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 678
           SPD R+   +YPH +    LG +P+A  F P+      +   P+T   +  G
Sbjct: 587 SPDARRRVMQYPHGNGPNGLGTSPSAGNFAPLPLGTSPSQFTPNTNNQFLAG 638


>At2g46830.1 68415.m05843 myb-related transcription factor (CCA1)
           identical to myb-related transcription factor (CCA1)
           GI:4090569 from [Arabidopsis thaliana]
          Length = 608

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = +1

Query: 694 KEGKADGKCLIEALDAILPPARPLTSP 774
           KE +A G  + +ALD  +PP RP   P
Sbjct: 74  KEAEAKGVAMGQALDIAIPPPRPKRKP 100


>At1g47840.1 68414.m05325 hexokinase, putative similar to hexokinase
           1 [Arabidopsis thaliana] Swiss-Prot:Q42525
          Length = 493

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +1

Query: 643 LEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 741
           ++  T   W KG++V   EGK    CL EA++A
Sbjct: 189 IDSGTLSKWTKGFKVSGMEGKNVVACLNEAMEA 221


>At5g04540.1 68418.m00454 expressed protein
          Length = 833

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 2/28 (7%)
 Frame = +2

Query: 548 QEGSILIHQED-W-ATTQLLSLSCPFLD 625
           +  S+L+H  D W  TTQL+SL+C  LD
Sbjct: 432 ESASVLVHCSDGWDRTTQLVSLACLLLD 459


>At3g10550.1 68416.m01266 expressed protein
          Length = 634

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 2/28 (7%)
 Frame = +2

Query: 548 QEGSILIHQED-W-ATTQLLSLSCPFLD 625
           +  S+L+H  D W  TTQL+SL+C  LD
Sbjct: 229 ESASVLVHCSDGWDRTTQLVSLACLLLD 256


>At2g43510.1 68415.m05406 trypsin inhibitor, putative similar to
           SP|P26780 Trypsin inhibitor 2 precursor (MTI-2) {Sinapis
           alba}
          Length = 89

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 12/22 (54%), Positives = 13/22 (59%)
 Frame = -3

Query: 804 IXYTSCREDAGACQGXGRWQDG 739
           I YT CRE+ GA  G  RW  G
Sbjct: 53  ICYTRCRENKGAKGGRCRWGQG 74


>At1g17220.1 68414.m02098 translation initiation factor IF-2,
           chloroplast, putative similar to SP|P57997|IF2C_PHAVU
           Translation initiation factor IF-2, chloroplast
           precursor (PvIF2cp) {Phaseolus vulgaris}
          Length = 1026

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 19/67 (28%), Positives = 29/67 (43%)
 Frame = +1

Query: 307 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 486
           +D PGH  F      G    D A+++VAA  G          QT E A+         ++
Sbjct: 557 LDTPGHEAFGAMRARGARVTDIAIIVVAADDG-------IRPQTNE-AIAHAKAAAVPIV 608

Query: 487 VGVNKMD 507
           + +NK+D
Sbjct: 609 IAINKID 615


>At5g26570.1 68418.m03152 glycoside hydrolase starch-binding
           domain-containing protein similar to SEX1 (starch
           excess) [Arabidopsis thaliana] GI:12044358; contains
           Pfam profile PF00686: Starch binding domain
          Length = 1191

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +1

Query: 610 VPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCL-IEALDAILPPARPLTS 771
           V +SGW  +  L    ++  ++   +  KEG+ DGK +    L A L  AR LT+
Sbjct: 571 VGLSGWKQEECLAIGNELLAWRERDLLEKEGEEDGKTIWAMRLKATLDRARRLTA 625


>At1g62660.1 68414.m07071 beta-fructosidase (BFRUCT3) /
           beta-fructofuranosidase / invertase, vacuolar identical
           to beta-fructosidase GB:CAA67560 GI:1429209 [Arabidopsis
           thaliana]; supported by full-length cDNA GI:14517549;
           identical to cDNA  Beta-fructosidase GI:3115854
          Length = 648

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 1/54 (1%)
 Frame = -3

Query: 537 IWAHCMVVQ*IHFVYSYDELFDTEGESEQGMLTG-LTVLRDTSFEFTGTGSYDE 379
           +W H +    IH++Y    +   +     G+ TG  T L D S     TGS DE
Sbjct: 148 VWGHAVSKDLIHWLYLPIAMVPDQWYDANGVWTGSATFLDDGSIVMLYTGSTDE 201


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,583,342
Number of Sequences: 28952
Number of extensions: 421806
Number of successful extensions: 1253
Number of sequences better than 10.0: 36
Number of HSP's better than 10.0 without gapping: 1163
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1228
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 2067932800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -