SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30142.Seq
         (600 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g02260.3 68417.m00305 RelA/SpoT protein, putative (RSH1) iden...    28   5.4  
At4g02260.2 68417.m00306 RelA/SpoT protein, putative (RSH1) iden...    28   5.4  
At4g02260.1 68417.m00307 RelA/SpoT protein, putative (RSH1) iden...    28   5.4  

>At4g02260.3 68417.m00305 RelA/SpoT protein, putative (RSH1)
           identical to RSH1 (RelA/SpoT homolog) [Arabidopsis
           thaliana] GI:7141304; contains Pfam profiles PF02824:
           TGS domain, PF01966: HD domain, PF04607: Region found in
           RelA / SpoT proteins
          Length = 816

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 2/36 (5%)
 Frame = +1

Query: 496 FVTSRTXPPPC-VPXXGX-GRRSQASRCTWRRFRGE 597
           F+ S   PP C V   G  GR+S+   C W+R+  E
Sbjct: 46  FLASTAHPPVCSVYSCGRNGRKSRMKACAWQRYEYE 81


>At4g02260.2 68417.m00306 RelA/SpoT protein, putative (RSH1)
           identical to RSH1 (RelA/SpoT homolog) [Arabidopsis
           thaliana] GI:7141304; contains Pfam profiles PF02824:
           TGS domain, PF01966: HD domain, PF04607: Region found in
           RelA / SpoT proteins
          Length = 883

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 2/36 (5%)
 Frame = +1

Query: 496 FVTSRTXPPPC-VPXXGX-GRRSQASRCTWRRFRGE 597
           F+ S   PP C V   G  GR+S+   C W+R+  E
Sbjct: 46  FLASTAHPPVCSVYSCGRNGRKSRMKACAWQRYEYE 81


>At4g02260.1 68417.m00307 RelA/SpoT protein, putative (RSH1)
           identical to RSH1 (RelA/SpoT homolog) [Arabidopsis
           thaliana] GI:7141304; contains Pfam profiles PF02824:
           TGS domain, PF01966: HD domain, PF04607: Region found in
           RelA / SpoT proteins
          Length = 884

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 2/36 (5%)
 Frame = +1

Query: 496 FVTSRTXPPPC-VPXXGX-GRRSQASRCTWRRFRGE 597
           F+ S   PP C V   G  GR+S+   C W+R+  E
Sbjct: 46  FLASTAHPPVCSVYSCGRNGRKSRMKACAWQRYEYE 81


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,878,358
Number of Sequences: 28952
Number of extensions: 148695
Number of successful extensions: 170
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 170
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 170
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1187288784
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -