SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30141.Seq
         (897 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g79350.1 68414.m09247 DNA-binding protein, putative contains ...    30   1.8  
At2g24120.2 68415.m02882 DNA-directed RNA polymerase, chloroplas...    29   3.2  
At2g24120.1 68415.m02881 DNA-directed RNA polymerase, chloroplas...    29   3.2  
At4g26780.1 68417.m03857 co-chaperone grpE family protein simila...    29   5.5  
At5g12890.1 68418.m01479 UDP-glucoronosyl/UDP-glucosyl transfera...    28   7.3  
At3g46700.1 68416.m05070 UDP-glucoronosyl/UDP-glucosyl transfera...    28   7.3  
At3g11964.1 68416.m01479 S1 RNA-binding domain-containing protei...    28   7.3  
At2g38570.1 68415.m04738 expressed protein ; expression supporte...    28   7.3  
At2g17120.1 68415.m01976 peptidoglycan-binding LysM domain-conta...    28   7.3  
At2g35490.1 68415.m04347 plastid-lipid associated protein PAP, p...    28   9.7  
At2g27940.1 68415.m03387 zinc finger (C3HC4-type RING finger) fa...    28   9.7  
At1g61660.2 68414.m06950 basic helix-loop-helix (bHLH) family pr...    28   9.7  
At1g61660.1 68414.m06949 basic helix-loop-helix (bHLH) family pr...    28   9.7  

>At1g79350.1 68414.m09247 DNA-binding protein, putative contains
           Pfam PF00628: PHD-finger domain; contains TIGRFAMS
           TIGR01053: zinc finger domain, LSD1 subclass; contains
           Pfam PF00271: Helicase conserved C-terminal domain;
           similar to WSSV086 (GI:19481678)[shrimp white spot
           syndrome virus]; similar to nuclear protein Np95
           (GI:17939938) [Mus musculus]
          Length = 1299

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = -2

Query: 236 SVTRHQAHAHPPTMVRFVVGPKQPPETIS 150
           S+T  Q+H++PPT     V P  PPE ++
Sbjct: 152 SLTASQSHSNPPTPAAPTVPPPPPPEEVN 180


>At2g24120.2 68415.m02882 DNA-directed RNA polymerase, chloroplast
            (RPOPT) identical to SP|O24600 DNA-directed RNA
            polymerase, chloroplast precursor (EC 2.7.7.6)
            {Arabidopsis thaliana}
          Length = 1035

 Score = 29.5 bits (63), Expect = 3.2
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = +1

Query: 643  GTLNVRVALANRDAGIREAXLRKTQWTSKYSIDTQN 750
            GT  +  A+A R+AG+  A +  + WT    +DT N
Sbjct: 904  GTHMMMTAVACREAGLNFAGVHDSYWTHACDVDTMN 939


>At2g24120.1 68415.m02881 DNA-directed RNA polymerase, chloroplast
            (RPOPT) identical to SP|O24600 DNA-directed RNA
            polymerase, chloroplast precursor (EC 2.7.7.6)
            {Arabidopsis thaliana}
          Length = 993

 Score = 29.5 bits (63), Expect = 3.2
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = +1

Query: 643  GTLNVRVALANRDAGIREAXLRKTQWTSKYSIDTQN 750
            GT  +  A+A R+AG+  A +  + WT    +DT N
Sbjct: 904  GTHMMMTAVACREAGLNFAGVHDSYWTHACDVDTMN 939


>At4g26780.1 68417.m03857 co-chaperone grpE family protein similar
           to chaperone GrpE type 2 [Nicotiana tabacum] GI:3851640;
           contains Pfam profile PF01025: co-chaperone GrpE
          Length = 327

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 13/22 (59%), Positives = 14/22 (63%)
 Frame = -1

Query: 285 TRTSGSMSSLQGYTLDVRNQTP 220
           TR +G  SSL   TL  RNQTP
Sbjct: 11  TRNAGIRSSLSAVTLPARNQTP 32


>At5g12890.1 68418.m01479 UDP-glucoronosyl/UDP-glucosyl transferase
           family protein contains Pfam profile: PF00201
           UDP-glucoronosyl and UDP-glucosyl transferase
          Length = 488

 Score = 28.3 bits (60), Expect = 7.3
 Identities = 14/54 (25%), Positives = 21/54 (38%)
 Frame = -3

Query: 394 LPRNCSQAVVRSSSSFMILHWATPVTVSGTPWAVSTYSHIGFNVITSGIYVGRP 233
           LP    + + RS    ++  WA  V +          SH G+N I   +  G P
Sbjct: 337 LPEGFEERITRSERGLLVKKWAPQVDILSHKATCVFLSHCGWNSILESLSHGVP 390


>At3g46700.1 68416.m05070 UDP-glucoronosyl/UDP-glucosyl transferase
           family protein contains Pfam profile: PF00201
           UDP-glucoronosyl and UDP-glucosyl transferase
          Length = 385

 Score = 28.3 bits (60), Expect = 7.3
 Identities = 17/54 (31%), Positives = 23/54 (42%)
 Frame = -3

Query: 394 LPRNCSQAVVRSSSSFMILHWATPVTVSGTPWAVSTYSHIGFNVITSGIYVGRP 233
           LP   S+ V+       I+ WA  + V G P     +SH G+N     I  G P
Sbjct: 248 LPEEVSKMVLEKG---YIVKWAPQIEVLGHPSVGGFWSHCGWNSTLESIVEGVP 298


>At3g11964.1 68416.m01479 S1 RNA-binding domain-containing protein
           similar to SP|Q05022 rRNA biogenesis protein RRP5
           {Saccharomyces cerevisiae}; contains Pfam profile
           PF00575: S1 RNA binding domain
          Length = 1838

 Score = 28.3 bits (60), Expect = 7.3
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = +2

Query: 494 GPIRGLVREVAAPDVGRMGIEILSFTIKDVYD 589
           G +RGLVR     D    GIE+ S  +K + D
Sbjct: 149 GGLRGLVRASEVSDFTDRGIEVFSANVKSIED 180


>At2g38570.1 68415.m04738 expressed protein ; expression supported
           by MPSS
          Length = 302

 Score = 28.3 bits (60), Expect = 7.3
 Identities = 10/33 (30%), Positives = 20/33 (60%)
 Frame = +1

Query: 34  GKLNKFVIVLVVKCSVCIVKVTVKGFKMGNIHT 132
           G+  +F++  +V+  +C+V  T+K    GN+ T
Sbjct: 164 GESERFLLTDIVRVLLCLVSATLKVVSFGNVFT 196


>At2g17120.1 68415.m01976 peptidoglycan-binding LysM
           domain-containing protein contains Pfam profile PF01476:
           LysM domain; supporting cDNA
           gi|16226688|gb|AF428464.1|AF428464
          Length = 350

 Score = 28.3 bits (60), Expect = 7.3
 Identities = 19/81 (23%), Positives = 34/81 (41%)
 Frame = -3

Query: 502 NWSLSLYTSSTVRVPRIARK*PSNVCRTVILISLTVLPRNCSQAVVRSSSSFMILHWATP 323
           NW+LS  +SS ++        P + C   +L +    PR+C  A   + + F     A P
Sbjct: 258 NWTLSCQSSSEIKPSNWQTCPPFSQCDGALLNASCRQPRDCVYAGYSNQTIFTTASPACP 317

Query: 322 VTVSGTPWAVSTYSHIGFNVI 260
            +     +A +  S   F ++
Sbjct: 318 DSAGPDNYASTLSSSFNFVIV 338


>At2g35490.1 68415.m04347 plastid-lipid associated protein PAP,
           putative similar to plastid-lipid associated protein
           PAP3 [Brassica rapa] GI:14248552; contains Pfam profile
           PF04755: PAP_fibrillin
          Length = 376

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = -1

Query: 723 RPLRFSQXRFPNTSISVSQSDTDVQRPSSRW 631
           +PLRFS+ R    S S S+SD D    +  W
Sbjct: 45  KPLRFSKIRSSLPSESESESDLDASAVTDEW 75


>At2g27940.1 68415.m03387 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 237

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 11/53 (20%), Positives = 31/53 (58%), Gaps = 2/53 (3%)
 Frame = -2

Query: 176 PKQPPETISASLGPTVWMLPILNPFTVTFTIHTLHF--TTKTITNLFNLPKNQ 24
           P QPP  + +++  T+++L +   F   F+++  HF  ++ +  ++ ++P+ +
Sbjct: 39  PPQPPSALDSTMALTIFILLVALFFMGFFSVYFRHFADSSSSTVDISSMPRTR 91


>At1g61660.2 68414.m06950 basic helix-loop-helix (bHLH) family
           protein contains Pfam domain, PF00010: Helix-loop-helix
           DNA-binding domain
          Length = 347

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 21/88 (23%), Positives = 39/88 (44%)
 Frame = -3

Query: 550 SHSSDVRRSHFAYQPANWSLSLYTSSTVRVPRIARK*PSNVCRTVILISLTVLPRNCSQA 371
           S SS + R+ +  +P+ ++    TS ++  P+++    +N    V    +     N +  
Sbjct: 150 SSSSSLIRTFYDPEPSPYNFVSTTSGSINDPQLSWANKTNPHHQVAYGLINSFSNNANSR 209

Query: 370 VVRSSSSFMILHWATPVTVSGTPWAVST 287
              +SSS   L+  TP     TP  +ST
Sbjct: 210 PFWNSSSTTNLNNTTPSNFVTTPQIIST 237


>At1g61660.1 68414.m06949 basic helix-loop-helix (bHLH) family
           protein contains Pfam domain, PF00010: Helix-loop-helix
           DNA-binding domain
          Length = 393

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 21/88 (23%), Positives = 39/88 (44%)
 Frame = -3

Query: 550 SHSSDVRRSHFAYQPANWSLSLYTSSTVRVPRIARK*PSNVCRTVILISLTVLPRNCSQA 371
           S SS + R+ +  +P+ ++    TS ++  P+++    +N    V    +     N +  
Sbjct: 150 SSSSSLIRTFYDPEPSPYNFVSTTSGSINDPQLSWANKTNPHHQVAYGLINSFSNNANSR 209

Query: 370 VVRSSSSFMILHWATPVTVSGTPWAVST 287
              +SSS   L+  TP     TP  +ST
Sbjct: 210 PFWNSSSTTNLNNTTPSNFVTTPQIIST 237


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,936,547
Number of Sequences: 28952
Number of extensions: 474262
Number of successful extensions: 1340
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 1290
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1340
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2110422216
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -