SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30139.Seq
         (697 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g22030.2 68418.m02564 ubiquitin-specific protease 8, putative...    58   6e-09
At5g22030.1 68418.m02563 ubiquitin-specific protease 8, putative...    58   6e-09
At1g32850.1 68414.m04048 ubiquitin carboxyl-terminal hydrolase f...    54   7e-08
At4g10570.1 68417.m01730 ubiquitin carboxyl-terminal hydrolase f...    53   2e-07
At4g10590.2 68417.m01733 ubiquitin carboxyl-terminal hydrolase f...    52   3e-07
At4g10590.1 68417.m01732 ubiquitin carboxyl-terminal hydrolase f...    52   3e-07
At2g24640.1 68415.m02943 ubiquitin carboxyl-terminal hydrolase f...    52   5e-07
At1g17110.1 68414.m02085 ubiquitin-specific protease 15 (UBP15) ...    51   8e-07
At2g32780.1 68415.m04013 ubiquitin-specific protease 1, putative...    48   4e-06
At2g40930.1 68415.m05052 ubiquitin-specific protease 5, putative...    48   8e-06
At5g65450.1 68418.m08231 ubiquitin carboxyl-terminal hydrolase f...    47   1e-05
At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase f...    47   1e-05
At5g10790.1 68418.m01254 ubiquitin-specific protease 22 (UBP22) ...    46   2e-05
At3g14400.1 68416.m01822 ubiquitin-specific protease 25 (UBP25) ...    46   3e-05
At2g22310.1 68415.m02647 ubiquitin-specific protease 4 (UBP4) id...    44   1e-04
At4g39910.1 68417.m05653 ubiquitin-specific protease 3 (UBP3) id...    44   1e-04
At4g24560.1 68417.m03520 ubiquitin-specific protease 16, putativ...    42   3e-04
At5g57990.1 68418.m07255 ubiquitin-specific protease 23, putativ...    41   7e-04
At1g04860.1 68414.m00482 ubiquitin-specific protease 2 (UBP2) id...    40   0.002
At4g17895.1 68417.m02667 ubiquitin-specific protease 20, putativ...    36   0.026
At3g49600.1 68416.m05421 ubiquitin-specific protease 26 (UBP26) ...    36   0.034
At5g46740.1 68418.m05758 ubiquitin-specific protease 21 (UBP21) ...    35   0.059
At5g06600.2 68418.m00746 ubiquitin-specific protease 12 (UBP12) ...    30   1.7  
At5g06600.1 68418.m00745 ubiquitin-specific protease 12 (UBP12) ...    30   1.7  
At3g11910.1 68416.m01460 ubiquitin-specific protease, putative s...    30   1.7  
At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa...    28   5.1  
At1g32640.1 68414.m04026 basic helix-loop-helix (bHLH) protein (...    27   9.0  

>At5g22030.2 68418.m02564 ubiquitin-specific protease 8, putative
           (UBP8) similar to ubiquitin-specific protease 8 partial
           sequence GI:11993469 [Arabidopsis thaliana]
          Length = 622

 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 33/106 (31%), Positives = 50/106 (47%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
           VSL  CL AF + + L  D+M+ C  CK+ R  +K   +  LP +L +HLKRF +     
Sbjct: 473 VSLFKCLEAFLTEEPLGPDDMWYCPGCKEHRQAIKKLDLWRLPEILVIHLKRFSYSRFMK 532

Query: 489 AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            K+                 +    +   RY L A+ +H G++GGG
Sbjct: 533 NKLEAYVDFPLDNLDLSSYISYKNGQTTYRYMLYAISNHYGSMGGG 578



 Score = 37.5 bits (83), Expect = 0.008
 Identities = 18/38 (47%), Positives = 23/38 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           SII DV  G+  S + C IC +VS   + F  LSLP+P
Sbjct: 172 SIIVDVCQGQYKSTLVCPICKKVSVMFDPFMYLSLPLP 209


>At5g22030.1 68418.m02563 ubiquitin-specific protease 8, putative
           (UBP8) similar to ubiquitin-specific protease 8 partial
           sequence GI:11993469 [Arabidopsis thaliana]
          Length = 622

 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 33/106 (31%), Positives = 50/106 (47%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
           VSL  CL AF + + L  D+M+ C  CK+ R  +K   +  LP +L +HLKRF +     
Sbjct: 473 VSLFKCLEAFLTEEPLGPDDMWYCPGCKEHRQAIKKLDLWRLPEILVIHLKRFSYSRFMK 532

Query: 489 AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            K+                 +    +   RY L A+ +H G++GGG
Sbjct: 533 NKLEAYVDFPLDNLDLSSYISYKNGQTTYRYMLYAISNHYGSMGGG 578



 Score = 37.5 bits (83), Expect = 0.008
 Identities = 18/38 (47%), Positives = 23/38 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           SII DV  G+  S + C IC +VS   + F  LSLP+P
Sbjct: 172 SIIVDVCQGQYKSTLVCPICKKVSVMFDPFMYLSLPLP 209


>At1g32850.1 68414.m04048 ubiquitin carboxyl-terminal hydrolase family
            protein similar to ubiquitin-specific protease UBP5
            [Arabidopsis thaliana] GI:6648604; contains Pfam profile
            PF00443: Ubiquitin carboxyl-terminal hydrolase
          Length = 892

 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 35/107 (32%), Positives = 51/107 (47%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            +SL  CL AF + + L  D+M+ C  CK+ R   K   +  LP +L  HLKRF +   F 
Sbjct: 733  ISLFSCLEAFLAEEPLGPDDMWYCPGCKEHRQANKKLDLWKLPDILVFHLKRFTYSRYFK 792

Query: 489  AKVXXXXXXXXTIWT*RLTR-TKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+         I    L++  K+       Y L A+ +H G +GGG
Sbjct: 793  NKIDTLVNFH--IHDLDLSKYVKNEDGQSYLYELYAISNHYGGLGGG 837



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 17/39 (43%), Positives = 24/39 (61%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           S+I DVF G+  S + C  C ++S   + F  LSLP+PS
Sbjct: 443 SVIVDVFQGQYKSTLVCPDCGKISITFDPFMYLSLPLPS 481


>At4g10570.1 68417.m01730 ubiquitin carboxyl-terminal hydrolase family
            protein similar to ubiquitin-specific protease UBP5
            [Arabidopsis thaliana] GI:6648604; contains Pfam profile
            PF00443: Ubiquitin carboxyl-terminal hydrolase
          Length = 923

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 33/107 (30%), Positives = 50/107 (46%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            +SL  CL AF + + L  D+M+ C  CK+ R   K   +  LP +L  HLKRF +     
Sbjct: 748  ISLFSCLEAFLAEEPLGPDDMWFCPSCKEHRQANKKLDLWKLPDILVFHLKRFTYSRYLK 807

Query: 489  AKV-XXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+          +   +  + K+    +  Y L AV +H G +GGG
Sbjct: 808  NKIDTFVNFPVHDLDLSKYVKNKNGQSYL--YELYAVSNHYGGLGGG 852



 Score = 36.3 bits (80), Expect = 0.019
 Identities = 15/39 (38%), Positives = 24/39 (61%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           S+I DV  G+  S + C +C ++S   + F  LS+P+PS
Sbjct: 446 SVIVDVCQGQYKSTLVCPVCGKISITFDPFMYLSVPLPS 484


>At4g10590.2 68417.m01733 ubiquitin carboxyl-terminal hydrolase family
            protein similar to ubiquitin-specific protease UBP5
            [Arabidopsis thaliana] GI:6648604; contains Pfam profile
            PF00443: Ubiquitin carboxyl-terminal hydrolase
          Length = 910

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 33/107 (30%), Positives = 50/107 (46%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            +SL  CL AF + + L  D+M+ C  CK+ R   K   +  LP +L  HLKRF +     
Sbjct: 747  ISLFSCLEAFLAEEPLGPDDMWFCPSCKEHRQANKKLDLWKLPDILVFHLKRFTYSRYLK 806

Query: 489  AKV-XXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+          +   +  + K+    +  Y L AV +H G +GGG
Sbjct: 807  NKIDTFVNFPVHDLDLSKYVKNKNDQSYL--YELYAVSNHYGGLGGG 851



 Score = 34.7 bits (76), Expect = 0.059
 Identities = 15/39 (38%), Positives = 23/39 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           S+I DV  G+  S + C  C ++S   + F  LS+P+PS
Sbjct: 445 SVIVDVCQGQYKSTLVCPACGKISITFDPFMYLSVPLPS 483


>At4g10590.1 68417.m01732 ubiquitin carboxyl-terminal hydrolase family
            protein similar to ubiquitin-specific protease UBP5
            [Arabidopsis thaliana] GI:6648604; contains Pfam profile
            PF00443: Ubiquitin carboxyl-terminal hydrolase
          Length = 910

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 33/107 (30%), Positives = 50/107 (46%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            +SL  CL AF + + L  D+M+ C  CK+ R   K   +  LP +L  HLKRF +     
Sbjct: 747  ISLFSCLEAFLAEEPLGPDDMWFCPSCKEHRQANKKLDLWKLPDILVFHLKRFTYSRYLK 806

Query: 489  AKV-XXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+          +   +  + K+    +  Y L AV +H G +GGG
Sbjct: 807  NKIDTFVNFPVHDLDLSKYVKNKNDQSYL--YELYAVSNHYGGLGGG 851



 Score = 34.7 bits (76), Expect = 0.059
 Identities = 15/39 (38%), Positives = 23/39 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           S+I DV  G+  S + C  C ++S   + F  LS+P+PS
Sbjct: 445 SVIVDVCQGQYKSTLVCPACGKISITFDPFMYLSVPLPS 483


>At2g24640.1 68415.m02943 ubiquitin carboxyl-terminal hydrolase
           family protein / zinc finger (MYND type) family protein
           similar to ubiquitin-specific protease 15 (UBP15)
           [Arabidopsis thaliana] GI:11993475; contains Pfam
           profiles PF00443: Ubiquitin carboxyl-terminal hydrolase,
           PF01753: MYND finger
          Length = 672

 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 23/58 (39%), Positives = 33/58 (56%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           +G  VSL++CL  F + + L+GDN+Y C RC       K   I   P +L + LKRF+
Sbjct: 330 HGDAVSLEECLDQFTAKEWLQGDNLYKCDRCDDYVKACKRLSIRCAPNILTIALKRFQ 387


>At1g17110.1 68414.m02085 ubiquitin-specific protease 15 (UBP15)
           almost identical to ubiquitin-specific protease 15
           GI:11993475 [Arabidopsis thaliana], 7 amino acid
           difference
          Length = 924

 Score = 50.8 bits (116), Expect = 8e-07
 Identities = 38/107 (35%), Positives = 48/107 (44%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           YG V SLQD L  F   ++L G+NMY CSRC       K   I   P +L + LKRF+ E
Sbjct: 594 YGWVESLQDALTQFTRPEDLDGENMYRCSRCAGYVRARKELSIHEAPNILTIVLKRFQ-E 652

Query: 477 LLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTV 617
             +                  +TRT   P     Y L AVI H+ T+
Sbjct: 653 GRYGKINKCISFPEMLDMIPFMTRTGDVP---PLYMLYAVIVHLDTL 696



 Score = 37.1 bits (82), Expect = 0.011
 Identities = 16/37 (43%), Positives = 23/37 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           +++  +F G+L S V+CL CD  S R E   DL+L I
Sbjct: 557 TLVQHMFGGRLRSKVKCLRCDHESERYENIMDLTLEI 593


>At2g32780.1 68415.m04013 ubiquitin-specific protease 1, putative
           (UBP1) similar to GI:11993461
          Length = 1083

 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 26/60 (43%), Positives = 33/60 (55%), Gaps = 2/60 (3%)
 Frame = +1

Query: 10  NSARAKSG--SSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           +S R K G   S D S  +  ++I  VF G++ S V CL C   S   E F DLSLP+PS
Sbjct: 303 SSLRKKLGVSDSNDSSTYQKPTLIDSVFGGEISSTVSCLECGHFSKVYEPFMDLSLPVPS 362



 Score = 28.7 bits (61), Expect = 3.9
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKK 395
           VS+  CLA F   + L  DN + C  C K
Sbjct: 799 VSVDRCLAQFTKHEILSEDNAWHCENCSK 827


>At2g40930.1 68415.m05052 ubiquitin-specific protease 5, putative
            (UBP5) similar to GI:6648604
          Length = 924

 Score = 47.6 bits (108), Expect = 8e-06
 Identities = 36/109 (33%), Positives = 51/109 (46%), Gaps = 3/109 (2%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            +SL  CL AF   + L  D M+ C +C + R   K   +  LP VL +HLKRF +    S
Sbjct: 768  LSLYACLEAFLREEPLVPDEMWFCPQCNERRQASKKLDLWRLPEVLVIHLKRFSYSR--S 825

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSR---YSLXAVISHMGTVGGG 626
             K          I    LT+   A + +S+   Y L A+ +H G +G G
Sbjct: 826  MKHKLETFVNFPIHDLDLTK-YVANKNLSQPQLYELYALTNHYGGMGSG 873



 Score = 35.5 bits (78), Expect = 0.034
 Identities = 17/37 (45%), Positives = 23/37 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           SII DV  G+  S + C IC++VS   + F  LSLP+
Sbjct: 459 SIIVDVCQGQYKSTLVCPICNKVSVTFDPFMYLSLPL 495


>At5g65450.1 68418.m08231 ubiquitin carboxyl-terminal hydrolase
           family protein / zinc finger (MYND type) family protein
           similar to ubiquitin-specific protease 16 (UBP16)
           [Arabidopsis thaliana] GI:11993477; contains Pfam
           profiles PF00443: Ubiquitin carboxyl-terminal hydrolase,
           PF01753: MYND finger
          Length = 731

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 23/59 (38%), Positives = 34/59 (57%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           G + SL++ LA F + + L G+N Y C RCK  +   K   I+  P +L V LKRF+ +
Sbjct: 483 GDIGSLEEALAQFTAYEVLDGENRYFCGRCKSYQKAKKKLMILEGPNILTVVLKRFQSD 541


>At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase
           family protein / zinc finger (MYND type) family protein
           similar to ubiquitin-specific protease 15 (UBP15)
           [Arabidopsis thaliana] GI:11993475; contains Pfam
           profiles PF00443: Ubiquitin carboxyl-terminal hydrolase,
           PF01753: MYND finger
          Length = 631

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 22/58 (37%), Positives = 31/58 (53%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           +G   SL++CL  F + + L GDNMY C RC       K   I   P +L + LKR++
Sbjct: 324 HGDAGSLEECLDQFTAEEWLHGDNMYKCDRCSDYVKACKRLTIRRAPNILTIALKRYQ 381



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 14/33 (42%), Positives = 20/33 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDL 165
           ++I  +F G L S VQC +C+ VS + E   DL
Sbjct: 287 TLIQYIFGGLLQSQVQCTVCNHVSDQYENMMDL 319


>At5g10790.1 68418.m01254 ubiquitin-specific protease 22 (UBP22)
           almost identical to ubiquitin-specific protease 22
           GI:11993484 [Arabidopsis thaliana], one amino acid
           difference
          Length = 557

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 21/56 (37%), Positives = 30/56 (53%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
           +L  CL  F  +++L  D   +C  C + R   K   I  LP +LC+H+KRF H L
Sbjct: 362 TLSGCLDFFTRSEKLGPDQKLNCQSCGEKRESSKQMSIRRLPLLLCLHVKRFEHSL 417



 Score = 31.9 bits (69), Expect = 0.42
 Identities = 17/55 (30%), Positives = 25/55 (45%)
 Frame = +1

Query: 52  NVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQ 216
           N + + I    F G L S V C  C   ST  + F D+SL + S    +   C++
Sbjct: 293 NEECQCITHKAFSGLLRSDVTCTTCGSTSTTYDPFIDISLTLDSMNGFSPADCRK 347


>At3g14400.1 68416.m01822 ubiquitin-specific protease 25 (UBP25)
           similar to GI:11993490
          Length = 661

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 28/100 (28%), Positives = 45/100 (45%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           S+++ L  FF ++ L G+N Y C  C+KL    K   I+  P +L + LKRF    +F  
Sbjct: 191 SVKESLQKFFQSEILDGNNKYRCESCEKLVTARKQMSILQAPNILVIQLKRFGG--IFGG 248

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
           K+         +       +K++      Y L  +I H G
Sbjct: 249 KIDKAISFGEILVLSNF-MSKASKDPQPEYKLFGIIVHSG 287



 Score = 34.7 bits (76), Expect = 0.059
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           S++ ++F G L S V+CL C   S + +   D+SL I
Sbjct: 150 SVVKEIFGGALQSQVKCLSCGAESNKADEIMDISLEI 186


>At2g22310.1 68415.m02647 ubiquitin-specific protease 4 (UBP4)
           identical to GI:2347100
          Length = 365

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 30/103 (29%), Positives = 48/103 (46%), Gaps = 2/103 (1%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH-ELLFS 488
           S+  CL  F S + L  ++ + C +C  L+   K   I   P +L +HLKRF++ E L  
Sbjct: 206 SITSCLKNFSSTETLHAEDKFFCDKCCSLQEAQKRMKIKKPPHILVIHLKRFKYMEQLGR 265

Query: 489 AKVXXXXXXXXTIWT*RLTRTKSAPRXVS-RYSLXAVISHMGT 614
            K          ++   L  + +    V   YSL AV+ H+G+
Sbjct: 266 YK----KLSYRVVFPLELKLSNTVDEYVDIEYSLFAVVVHVGS 304



 Score = 35.9 bits (79), Expect = 0.026
 Identities = 20/61 (32%), Positives = 33/61 (54%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQPMLNHHAAHNAQ 252
           +  +F G L +  +CL C+ V+ R ETF DLSL I   ++ ++  C +   +    H A+
Sbjct: 167 VHKIFQGILTNETRCLRCETVTARDETFLDLSLDI--EQNSSITSCLKNFSSTETLH-AE 223

Query: 253 D 255
           D
Sbjct: 224 D 224


>At4g39910.1 68417.m05653 ubiquitin-specific protease 3 (UBP3)
           identical to GI:2347098
          Length = 371

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 30/103 (29%), Positives = 49/103 (47%), Gaps = 2/103 (1%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH--ELLF 485
           S+  CL  F S + L  ++ + C +C  L+   K   I   P +L +HLKRF++  +L  
Sbjct: 211 SITSCLKNFSSTETLHAEDKFFCDKCCSLQEAQKRMKIKKPPHILVIHLKRFKYIEQLGR 270

Query: 486 SAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGT 614
             K+         +   +L+ T   P     YSL AV+ H+G+
Sbjct: 271 YKKLSYRVVFPLEL---KLSNTVE-PYADVEYSLFAVVVHVGS 309



 Score = 36.7 bits (81), Expect = 0.015
 Identities = 20/61 (32%), Positives = 34/61 (55%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQPMLNHHAAHNAQ 252
           + ++F G L +  +CL C+ V+ R ETF DLSL I   ++ ++  C +   +    H A+
Sbjct: 172 VHNIFQGILTNETRCLRCETVTARDETFLDLSLDI--EQNSSITSCLKNFSSTETLH-AE 228

Query: 253 D 255
           D
Sbjct: 229 D 229


>At4g24560.1 68417.m03520 ubiquitin-specific protease 16, putative
           (UBP16) similar to ubiquitin-specific protease 16
           GI:11993477 [Arabidopsis thaliana]
          Length = 1008

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 21/57 (36%), Positives = 27/57 (47%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           G + +L D L  F   + L G+N Y C  CK      K   I   P VL + LKRF+
Sbjct: 699 GDISTLDDALRRFTRTEILDGENKYRCGSCKSYERAKKKLKITEPPNVLTIALKRFQ 755


>At5g57990.1 68418.m07255 ubiquitin-specific protease 23, putative
           (UBP23) identical to GI:11993486
          Length = 859

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 20/56 (35%), Positives = 29/56 (51%)
 Frame = +1

Query: 28  SGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           SG   + S+   RS++  +F G L S V+C  C   S + + F DLSL I   + L
Sbjct: 212 SGVPSESSDAYRRSLVHKIFGGSLRSQVKCEQCSHCSNKFDPFLDLSLDISKADSL 267



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = +3

Query: 312 SLQDCLAAFFSADEL-KGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           SLQ  L+ F + + L  G  +Y C RCK+     K   +   P VL VHLKRF
Sbjct: 266 SLQRALSRFTAVELLDNGAKVYQCERCKQKVKAKKQLTVSKAPYVLTVHLKRF 318


>At1g04860.1 68414.m00482 ubiquitin-specific protease 2 (UBP2)
           identical to GI:11993463
          Length = 961

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 22/60 (36%), Positives = 32/60 (53%)
 Frame = +1

Query: 10  NSARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           ++ R K G S +    K  ++I  VF G+  S V C+ C   S   E F DLSLP+P ++
Sbjct: 332 SALRKKRGVSDNDE--KSTTLIESVFGGETSSIVSCMECGHSSKVYEPFLDLSLPVPFKK 389



 Score = 28.7 bits (61), Expect = 3.9
 Identities = 11/29 (37%), Positives = 16/29 (55%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKK 395
           VS++ CL  F   + L  DN ++C  C K
Sbjct: 709 VSVERCLGHFTKHEILSDDNAWNCENCSK 737



 Score = 28.3 bits (60), Expect = 5.1
 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
 Frame = +3

Query: 399  RNGVKLSGIVVLPXVLCVHLKRFRHELLFS-AKVXXXXXXXXTIWT*RLTRTKSAPRXVS 575
            R+  K   I   P VL +HLKRF  +L    +K+         I   +   ++ +     
Sbjct: 830  RDATKKVLINKAPPVLTIHLKRFSQDLRGRLSKLNGHVAFKEVIDLRQYMDSRCSGEDPP 889

Query: 576  RYSLXAVISHMGTVGGG 626
             Y L  ++ H GT+ GG
Sbjct: 890  VYRLAGLVEHSGTMRGG 906


>At4g17895.1 68417.m02667 ubiquitin-specific protease 20, putative
           (UBP20) identical to ubiquitin-specific protease 20
           GI:11993480 [Arabidopsis thaliana]
          Length = 695

 Score = 35.9 bits (79), Expect = 0.026
 Identities = 26/102 (25%), Positives = 42/102 (41%)
 Frame = +3

Query: 306 VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLF 485
           V +L   L +F   ++L  D   +C  C +  +  K   +  LP V   HLKRF++  L+
Sbjct: 329 VDTLGSALESFTRVEKL--DEQLTCDNCNEKVSKEKQLLLDKLPLVATFHLKRFKNNGLY 386

Query: 486 SAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
             K+         I      R        ++Y L A++ H G
Sbjct: 387 MEKIYKHVKIPLEIDLQPYMRNIQENEVSTKYHLYALVEHFG 428



 Score = 33.1 bits (72), Expect = 0.18
 Identities = 16/33 (48%), Positives = 20/33 (60%)
 Frame = +1

Query: 79  DVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           DVF G+L+S ++C  CD VS   E    LSL I
Sbjct: 294 DVFSGRLISGLRCCNCDYVSETYEKSVGLSLEI 326


>At3g49600.1 68416.m05421 ubiquitin-specific protease 26 (UBP26)
           similar to GI:11993492; RNA binding protein - Homo
           sapiens, EMBL:AB016089 (N-terminus), several ubiquitin
           carboxyl-terminal hydrolases from aa pos. 712
          Length = 1067

 Score = 35.5 bits (78), Expect = 0.034
 Identities = 17/51 (33%), Positives = 24/51 (47%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKR 464
           SL   L  + S ++L GDN Y C  C    +  +   +  LP V+   LKR
Sbjct: 253 SLDASLNDYLSLEQLNGDNQYFCGSCNARVDATRCIKLRTLPPVITFQLKR 303



 Score = 29.5 bits (63), Expect = 2.2
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 3/52 (5%)
 Frame = +1

Query: 49  SNVKYRSIISDVFXGKLLSAVQCLICDR---VSTRIETFQDLSLPIPSREHL 195
           S VK ++I+ D+F G +     C  C R    S+++E F  L L +   + L
Sbjct: 203 SGVKAKTIVQDLFSGSVSHVTTCSKCGRDSEASSKMEDFYALELNVKGLKSL 254


>At5g46740.1 68418.m05758 ubiquitin-specific protease 21 (UBP21)
           identical to ubiquitin-specific protease 21 GI:11993482
           [Arabidopsis thaliana]
          Length = 732

 Score = 34.7 bits (76), Expect = 0.059
 Identities = 25/102 (24%), Positives = 42/102 (41%)
 Frame = +3

Query: 306 VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLF 485
           V +L   L +F   ++L  ++  +C  CK+     K      LP V   HLKRF ++ + 
Sbjct: 322 VNTLWKALESFTCVEKL--EDQLTCDNCKEKVTKEKQLRFDKLPPVATFHLKRFTNDGVT 379

Query: 486 SAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
             K+         +       +   P   +RY L A + H+G
Sbjct: 380 MEKIFDHIEFPLELDLSPFMSSNHDPEVSTRYHLYAFVEHIG 421


>At5g06600.2 68418.m00746 ubiquitin-specific protease 12 (UBP12)
           almost identical to ubiquitin-specific protease 12
           GI:11993471 [Arabidopsis thaliana], one amino acid
           difference
          Length = 1115

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           I  +F G  ++ ++C+  D  STR E+F DL L +
Sbjct: 305 IQQLFEGHHMNYIECINVDFKSTRKESFYDLQLDV 339


>At5g06600.1 68418.m00745 ubiquitin-specific protease 12 (UBP12)
           almost identical to ubiquitin-specific protease 12
           GI:11993471 [Arabidopsis thaliana], one amino acid
           difference
          Length = 1116

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           I  +F G  ++ ++C+  D  STR E+F DL L +
Sbjct: 306 IQQLFEGHHMNYIECINVDFKSTRKESFYDLQLDV 340


>At3g11910.1 68416.m01460 ubiquitin-specific protease, putative
           strong similarity to ubiquitin-specific protease 12
           (UBP12) [Arabidopsis thaliana] GI:11993471; contains
           Pfam profiles PF00443: Ubiquitin carboxyl-terminal
           hydrolase, PF00917: MATH domain
          Length = 1115

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           I  +F G  ++ ++C+  D  STR E+F DL L +
Sbjct: 305 IQKLFEGHHMNYIECINVDYKSTRKESFYDLQLDV 339


>At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam
           profiles PF00085: Thioredoxin, PF00515: TPR Domain;
           similar to tetratricopeptide repeat protein 2
           (GI:7248701) [Drosophila melanogaster]; similar to DnaJ
           homolog subfamily C member 7 (Tetratricopeptide repeat
           protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615)
           [Homo sapiens]
          Length = 699

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 9/19 (47%), Positives = 13/19 (68%)
 Frame = -3

Query: 239 AAWWFSMGCWQRSTAKCSR 183
           AA WF +G W+RS   C++
Sbjct: 506 AACWFKLGMWERSIEDCNQ 524


>At1g32640.1 68414.m04026 basic helix-loop-helix (bHLH) protein
           (RAP-1) identical to bHLH protein GB:CAA67885 GI:1465368
           from [Arabidopsis thaliana]
          Length = 623

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = +1

Query: 322 TVWPPSSAPTNSKATTCTAAPA 387
           T+WPP+S  T +  T  T  PA
Sbjct: 33  TLWPPASTTTTTATTETTPTPA 54


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,158,062
Number of Sequences: 28952
Number of extensions: 226629
Number of successful extensions: 661
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 607
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 651
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1487069504
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -