SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30137.Seq
         (875 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g07890.1 68418.m00910 myosin heavy chain-related contains wea...    31   0.76 
At1g05320.1 68414.m00539 myosin-related similar to non-muscle my...    31   1.3  
At3g28770.1 68416.m03591 expressed protein                             30   2.3  
At1g04550.2 68414.m00448 auxin-responsive protein / indoleacetic...    30   2.3  
At1g04550.1 68414.m00447 auxin-responsive protein / indoleacetic...    30   2.3  
At3g25440.1 68416.m03163 group II intron splicing factor CRS1-re...    29   3.1  
At3g16840.1 68416.m02150 DEAD/DEAH box helicase, putative (RH13)...    29   4.1  
At1g63540.1 68414.m07183 hydroxyproline-rich glycoprotein family...    29   4.1  
At5g44310.2 68418.m05424 late embryogenesis abundant domain-cont...    29   5.4  
At5g44310.1 68418.m05423 late embryogenesis abundant domain-cont...    29   5.4  
At4g09460.1 68417.m01557 myb family transcription factor               29   5.4  
At3g02930.1 68416.m00288 expressed protein  ; expression support...    29   5.4  
At1g49160.2 68414.m05512 protein kinase family protein contains ...    29   5.4  
At1g49160.1 68414.m05511 protein kinase family protein contains ...    29   5.4  
At3g53000.1 68416.m05842 F-box family protein / SKP1 interacting...    28   7.1  
At3g28510.1 68416.m03561 AAA-type ATPase family protein contains...    28   7.1  
At3g02860.2 68416.m00279 expressed protein                             28   7.1  
At3g02860.1 68416.m00278 expressed protein                             28   7.1  
At1g58270.1 68414.m06628 meprin and TRAF homology domain-contain...    28   7.1  
At5g23760.1 68418.m02790 heavy-metal-associated domain-containin...    28   9.4  
At1g77460.1 68414.m09020 C2 domain-containing protein / armadill...    28   9.4  
At1g35515.1 68414.m04409 myb family transcription factor (MYB8) ...    28   9.4  

>At5g07890.1 68418.m00910 myosin heavy chain-related contains weak
           similarity to Myosin heavy chain, cardiac muscle alpha
           isoform (MyHC-alpha) (Alpha isomyosin) (Fragment)
           (Swiss-Prot:P04460) [Oryctolagus cuniculus]
          Length = 409

 Score = 31.5 bits (68), Expect = 0.76
 Identities = 26/114 (22%), Positives = 50/114 (43%), Gaps = 5/114 (4%)
 Frame = +2

Query: 179 ERETIQDNIESNASCWQRAISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKA 358
           ER   +D    NA C+   +SH L  S +    +D   K +L+  Q + + +  + M K 
Sbjct: 264 ERLESEDEQPLNAMCFFAELSHVLPVSNEVRNCFDAIMK-KLELSQNVNLIDKVEGMGKQ 322

Query: 359 KAEEENTEKRSQNLDEAKKILLQED-----PSLPKATVVKICETTEHRGQRICI 505
             + E+  K+ +   + +K+  +E+       + +      C   E R +R+CI
Sbjct: 323 IHQHEDVVKQLKEELKQEKLKAKEEAEDLTQEMAELRYKMTCLLDEERNRRVCI 376


>At1g05320.1 68414.m00539 myosin-related similar to non-muscle
           myosin II heavy chain (GI:19879404) [Loligo pealei];
           ESTs gb|AA042402,gb|ATTS1380 come from this gene
          Length = 828

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
 Frame = +2

Query: 332 ENYKA-MDKAKAEEENTEKRSQNLDEAKKILLQEDPSLPKATVVKICETTEHRGQR 496
           EN  A M+K K+ EE  EK+++ +DEA    ++ + +L K + +K+ +T E    R
Sbjct: 289 ENLNAVMEKLKSSEERLEKQAREIDEATTRSIELE-ALHKHSELKVQKTMEDFSSR 343


>At3g28770.1 68416.m03591 expressed protein 
          Length = 2081

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 19/81 (23%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = +2

Query: 179  ERETIQDNIESNASCWQRAISHNLCYSKDDTKDYDVAAKSQLKKIQKI--WVRENYKAMD 352
            ++E+   N++      +  +++ L   +D+ K+   +  S+LK+  K     +E+  +  
Sbjct: 948  KKESKNSNMKKKEEDKKEYVNNELKKQEDNKKETTKSENSKLKEENKDNKEKKESEDSAS 1007

Query: 353  KAKAEEENTEKRSQNLDEAKK 415
            K + ++E  EK+S+  +EAKK
Sbjct: 1008 KNREKKEYEEKKSKTKEEAKK 1028


>At1g04550.2 68414.m00448 auxin-responsive protein / indoleacetic
           acid-induced protein 12 (IAA12) identical to SP|Q38830
           Auxin-responsive protein IAA12 (Indoleacetic
           acid-induced protein 12) {Arabidopsis thaliana}
          Length = 239

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 15/44 (34%), Positives = 25/44 (56%)
 Frame = +2

Query: 335 NYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLPKATVVKI 466
           N +AM  A+AEE + EK+    DE K + ++ +P +     VK+
Sbjct: 86  NNQAMKAARAEEGDGEKKVVKNDELKDVSMKVNPKVQGLGFVKV 129


>At1g04550.1 68414.m00447 auxin-responsive protein / indoleacetic
           acid-induced protein 12 (IAA12) identical to SP|Q38830
           Auxin-responsive protein IAA12 (Indoleacetic
           acid-induced protein 12) {Arabidopsis thaliana}
          Length = 173

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 15/44 (34%), Positives = 25/44 (56%)
 Frame = +2

Query: 335 NYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLPKATVVKI 466
           N +AM  A+AEE + EK+    DE K + ++ +P +     VK+
Sbjct: 86  NNQAMKAARAEEGDGEKKVVKNDELKDVSMKVNPKVQGLGFVKV 129


>At3g25440.1 68416.m03163 group II intron splicing factor
           CRS1-related contains weak similarity to CRS1 [Zea mays]
           gi|9837550|gb|AAG00595
          Length = 380

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 1/33 (3%)
 Frame = +2

Query: 332 ENYKAMDKAKAE-EENTEKRSQNLDEAKKILLQ 427
           E++  + KAK+E EEN + +S N DE  K+ L+
Sbjct: 338 EDFGDLGKAKSEGEENDDDKSPNFDEVDKMFLR 370


>At3g16840.1 68416.m02150 DEAD/DEAH box helicase, putative (RH13)
           similar to RNA helicase GB:CAA09204 from [Arabidopsis
           thaliana]; identical to cDNA DEAD box RNA helicase, RH13
           GI:3776002
          Length = 832

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 10/45 (22%), Positives = 26/45 (57%)
 Frame = +2

Query: 278 YDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAK 412
           Y++  K   +   + W++++ ++M+    +EE+ E+R  N+ + K
Sbjct: 650 YEIERKGSRENADRTWLKKHAESMELELDDEESEEERVDNVRQRK 694


>At1g63540.1 68414.m07183 hydroxyproline-rich glycoprotein family
           protein
          Length = 635

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = -1

Query: 800 CTSGKASSLRMASHHLVVRVQSIPQ*SAVSS*PPGAFFPS 681
           CT+  A+S   AS H      + P  +A +  PPG FFPS
Sbjct: 558 CTACGATSSSSASRHFTFNGATSPPSAATT--PPGLFFPS 595


>At5g44310.2 68418.m05424 late embryogenesis abundant
           domain-containing protein / LEA domain-containing
           protein low similarity to 51 kDa seed maturation protein
           [Glycine max] GI:414977; contains Pfam profile PF02987:
           Late embryogenesis abundant protein
          Length = 331

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 17/79 (21%), Positives = 38/79 (48%)
 Frame = +2

Query: 260 KDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPS 439
           K+ TKDY   AK ++ +       + Y+  +KAK +  + ++++++  E  K  + E  S
Sbjct: 141 KEKTKDYAEEAKDKVNEGASRAADKAYETKEKAKDKAYDVKEKTKDFAEETKEKVNEGAS 200

Query: 440 LPKATVVKICETTEHRGQR 496
                   + E T++  ++
Sbjct: 201 RAADKAYDVKEKTKNYAEQ 219


>At5g44310.1 68418.m05423 late embryogenesis abundant
           domain-containing protein / LEA domain-containing
           protein low similarity to 51 kDa seed maturation protein
           [Glycine max] GI:414977; contains Pfam profile PF02987:
           Late embryogenesis abundant protein
          Length = 295

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 17/79 (21%), Positives = 38/79 (48%)
 Frame = +2

Query: 260 KDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPS 439
           K+ TKDY   AK ++ +       + Y+  +KAK +  + ++++++  E  K  + E  S
Sbjct: 105 KEKTKDYAEEAKDKVNEGASRAADKAYETKEKAKDKAYDVKEKTKDFAEETKEKVNEGAS 164

Query: 440 LPKATVVKICETTEHRGQR 496
                   + E T++  ++
Sbjct: 165 RAADKAYDVKEKTKNYAEQ 183


>At4g09460.1 68417.m01557 myb family transcription factor
          Length = 236

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 14/45 (31%), Positives = 22/45 (48%)
 Frame = +1

Query: 454 CCENM*NN*TPWSEDMHQRWVHRLRRQGKSLAFLTLRDGTGYLQC 588
           CCE    N   W+++  QR V  +R  G+   + +L    G L+C
Sbjct: 6   CCEKAHTNKGAWTKEEDQRLVDYIRNHGEG-CWRSLPKSAGLLRC 49


>At3g02930.1 68416.m00288 expressed protein  ; expression supported
           by MPSS
          Length = 806

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 3/51 (5%)
 Frame = +2

Query: 266 DTKDYDVAAKSQLKKIQKIWV---RENYKAMDKAKAEEENTEKRSQNLDEA 409
           +++   V  K  LKK  ++      E  KA+D+ K   +  E+ S+ LDEA
Sbjct: 84  ESQPQSVQIKEDLKKANELIASLENEKAKALDQLKEARKEAEEASEKLDEA 134


>At1g49160.2 68414.m05512 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 557

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 5/85 (5%)
 Frame = +2

Query: 179 ERETIQDNIESNASCWQ-RAISHNL----CYSKDDTKDYDVAAKSQLKKIQKIWVRENYK 343
           + ++ +DN ++ AS     +ISH+L    C   DD  +  VAA ++ ++ +K    E  +
Sbjct: 451 QNQSSKDNHQNGASSQAGESISHSLSSDYCPRSDDEANPTVAATTEDQEAEKPGSLEEEE 510

Query: 344 AMDKAKAEEENTEKRSQNLDEAKKI 418
             ++ K E E  E+R +  +E K+I
Sbjct: 511 EDERLKEELEKIEERFR--EEMKEI 533


>At1g49160.1 68414.m05511 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 539

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 5/85 (5%)
 Frame = +2

Query: 179 ERETIQDNIESNASCWQ-RAISHNL----CYSKDDTKDYDVAAKSQLKKIQKIWVRENYK 343
           + ++ +DN ++ AS     +ISH+L    C   DD  +  VAA ++ ++ +K    E  +
Sbjct: 433 QNQSSKDNHQNGASSQAGESISHSLSSDYCPRSDDEANPTVAATTEDQEAEKPGSLEEEE 492

Query: 344 AMDKAKAEEENTEKRSQNLDEAKKI 418
             ++ K E E  E+R +  +E K+I
Sbjct: 493 EDERLKEELEKIEERFR--EEMKEI 515


>At3g53000.1 68416.m05842 F-box family protein / SKP1 interacting
           partner 3-related low similarity to SKP1 interacting
           partner 3 [Arabidopsis thaliana] GI:10716951; contains
           Pfam profile PF00646: F-box domain
          Length = 300

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = +3

Query: 540 ISGIPDPA*WHWVPTVRSTWFTMSDLQ 620
           I+GI D   W+W+PT  S +  ++ LQ
Sbjct: 126 ITGIEDRRYWNWIPTEESRFHVVAYLQ 152


>At3g28510.1 68416.m03561 AAA-type ATPase family protein contains
           Pfam profile: PF00004 ATPase family
          Length = 530

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = +2

Query: 260 KDDTKDYDVAAKSQLKKIQ--KIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
           K D +D D+  K  +K ++  K   R+  +  +K KAE+E  + +     E KK   +ED
Sbjct: 440 KSDEEDADICIKRLVKTLEEEKEKARKLAEEEEKKKAEKEAKKMKKAEEAEEKKKKTEED 499

Query: 434 PSLPK 448
               K
Sbjct: 500 EKKEK 504


>At3g02860.2 68416.m00279 expressed protein
          Length = 313

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 17/74 (22%), Positives = 37/74 (50%)
 Frame = +2

Query: 260 KDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPS 439
           KD+ K+++   +  L+ +     R   + +D A+  EE  ++  ++  E  +IL ++   
Sbjct: 211 KDEYKEFEKLIQDDLQVVDS---RMEEEEVDAAETIEEEEQREQRSYKEKVEILKRKKME 267

Query: 440 LPKATVVKICETTE 481
           L  A + K  +T+E
Sbjct: 268 LKAARLAKRSKTSE 281


>At3g02860.1 68416.m00278 expressed protein
          Length = 312

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 17/74 (22%), Positives = 37/74 (50%)
 Frame = +2

Query: 260 KDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPS 439
           KD+ K+++   +  L+ +     R   + +D A+  EE  ++  ++  E  +IL ++   
Sbjct: 210 KDEYKEFEKLIQDDLQVVDS---RMEEEEVDAAETIEEEEQREQRSYKEKVEILKRKKME 266

Query: 440 LPKATVVKICETTE 481
           L  A + K  +T+E
Sbjct: 267 LKAARLAKRSKTSE 280


>At1g58270.1 68414.m06628 meprin and TRAF homology domain-containing
           protein / MATH domain-containing protein similar to
           ubiquitin-specific protease 12 [Arabidopsis thaliana]
           GI:11993471; contains Pfam profile PF00917: MATH domain
          Length = 396

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -1

Query: 500 ISSDHGVQLFHIFSQQWPLVNLDPL 426
           IS +   Q FH+F QQW L+   P+
Sbjct: 184 ISQETEAQRFHLFKQQWGLLQFLPI 208


>At5g23760.1 68418.m02790 heavy-metal-associated domain-containing
           protein  Pfam profile PF00403: Heavy-metal-associated
           domain
          Length = 103

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 16/51 (31%), Positives = 29/51 (56%)
 Frame = +2

Query: 284 VAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDP 436
           VA   +LKK+ K+ +     A ++ K EE+  EK+ +  +E K+   +E+P
Sbjct: 52  VAVVKKLKKVGKVDLISVGPAKEEKK-EEKKEEKKEEKKEEKKEEQKEEEP 101


>At1g77460.1 68414.m09020 C2 domain-containing protein /
            armadillo/beta-catenin repeat family protein similar to
            CCLS 65 [Silene latifolia] GI:2570102; contains Pfam
            profiles PF00514: Armadillo/beta-catenin-like repeat,
            PF00168: C2 domain
          Length = 2110

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 1/65 (1%)
 Frame = +2

Query: 254  YSKDDTKDYDVAAKSQLKKIQKIWVREN-YKAMDKAKAEEENTEKRSQNLDEAKKILLQE 430
            + +D T    V    +L  I  + ++E   KA++K  A        ++ + E  K++LQE
Sbjct: 1563 FQQDITTQSAVVPLVRLAGIGILSLQETAIKALEKISASWPKAVLDAEGIFELSKVILQE 1622

Query: 431  DPSLP 445
            DP  P
Sbjct: 1623 DPQPP 1627


>At1g35515.1 68414.m04409 myb family transcription factor (MYB8)
           similar to DNA-binding protein GB:AAA98761 GI:1020155
           from [Arabidopsis thaliana]
          Length = 212

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 13/45 (28%), Positives = 23/45 (51%)
 Frame = +1

Query: 454 CCENM*NN*TPWSEDMHQRWVHRLRRQGKSLAFLTLRDGTGYLQC 588
           CCE    N   W+++  QR +  +R  G+  ++ +L    G L+C
Sbjct: 6   CCEKAHMNKGAWTKEEDQRLIDYIRNHGEG-SWRSLPKSVGLLRC 49


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,096,362
Number of Sequences: 28952
Number of extensions: 410976
Number of successful extensions: 1124
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 1078
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1122
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 2058178400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -