SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30136.Seq
         (884 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g58340.1 68418.m07305 expressed protein ; expression supporte...    29   4.1  
At5g14920.1 68418.m01750 gibberellin-regulated family protein si...    28   9.5  

>At5g58340.1 68418.m07305 expressed protein ; expression supported
           by MPSS
          Length = 466

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 13/36 (36%), Positives = 24/36 (66%)
 Frame = +2

Query: 59  RIHNPPTTPIRPNNSTLTAMAVGDLFDCNRIKLTSL 166
           R HNP  +PI    + ++A+ +GD  DC ++K++S+
Sbjct: 15  RQHNPRASPI----NLISALKLGDSSDCIKLKISSV 46


>At5g14920.1 68418.m01750 gibberellin-regulated family protein
           similar to SP|P46689 Gibberellin-regulated protein 1
           precursor {Arabidopsis thaliana}; contains Pfam profile
           PF02704: Gibberellin regulated protein
          Length = 275

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 11/30 (36%), Positives = 14/30 (46%)
 Frame = +2

Query: 5   PVTEQQSPHTAALPPRTTRIHNPPTTPIRP 94
           P T          PP     +NPPTTP++P
Sbjct: 167 PTTTPPVKPPTTTPPVQPPTYNPPTTPVKP 196


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,723,948
Number of Sequences: 28952
Number of extensions: 277239
Number of successful extensions: 571
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 514
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 571
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2071520424
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -