SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30135.Seq
         (856 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496...   184   9e-47
At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 A...   183   1e-46
At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497...   183   1e-46
At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to S...   182   4e-46
At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 A...   181   5e-46
At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 A...   181   5e-46
At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 A...   181   5e-46
At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 A...   181   6e-46
At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 A...   181   6e-46
At2g42100.1 68415.m05205 actin, putative very strong similarity ...   163   1e-40
At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Ara...   156   2e-38
At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Ac...   151   8e-37
At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly i...   104   7e-23
At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identica...    95   7e-20
At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary id...    80   2e-15
At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identica...    64   1e-10
At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identica...    63   3e-10
At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly i...    55   7e-08
At3g12380.1 68416.m01543 actin/actin-like family protein similar...    49   5e-06
At5g56180.2 68418.m07009 actin-related protein, putative (ARP8) ...    41   0.001
At5g56180.1 68418.m07008 actin-related protein, putative (ARP8) ...    41   0.001
At5g01040.1 68418.m00007 laccase family protein / diphenol oxida...    34   0.14 
At2g22470.1 68415.m02664 arabinogalactan-protein (AGP2) identica...    32   0.56 
At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t...    31   0.74 
At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel...    31   0.74 
At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t...    31   0.98 
At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t...    31   0.98 
At5g17420.1 68418.m02044 cellulose synthase, catalytic subunit (...    31   1.3  
At1g70080.1 68414.m08063 terpene synthase/cyclase family protein...    30   2.3  
At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein c...    30   2.3  
At4g27850.1 68417.m03999 proline-rich family protein contains pr...    29   3.0  
At3g51050.1 68416.m05590 FG-GAP repeat-containing protein              29   3.9  
At1g51090.1 68414.m05744 heavy-metal-associated domain-containin...    29   3.9  
At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family p...    29   3.9  
At1g16690.2 68414.m01999 transcription factor-related similar to...    29   5.2  
At1g16690.1 68414.m01998 transcription factor-related similar to...    29   5.2  
At4g13350.2 68417.m02088 human Rev interacting-like protein-rela...    28   6.9  
At4g13350.1 68417.m02087 human Rev interacting-like protein-rela...    28   6.9  
At1g02890.1 68414.m00256 AAA-type ATPase family protein contains...    28   6.9  
At5g18270.2 68418.m02148 no apical meristem (NAM) family protein...    28   9.1  
At5g18270.1 68418.m02147 no apical meristem (NAM) family protein...    28   9.1  
At3g28790.1 68416.m03593 expressed protein                             28   9.1  

>At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496
           Actin 11 {Arabidopsis thaliana}
          Length = 377

 Score =  184 bits (447), Expect = 9e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNTPAMYVAIQAVLSL 144



 Score =  126 bits (305), Expect = 1e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 145 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
           +A REI     KEKL Y+
Sbjct: 205 SAEREIVR-DVKEKLAYI 221



 Score =  105 bits (252), Expect = 4e-23
 Identities = 47/59 (79%), Positives = 53/59 (89%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDE ++K
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494
           Actin 4 {Arabidopsis thaliana}
          Length = 377

 Score =  183 bits (446), Expect = 1e-46
 Identities = 84/85 (98%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNTPAMYVAIQAVLSL 144



 Score =  124 bits (299), Expect = 8e-29
 Identities = 62/78 (79%), Positives = 65/78 (83%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTD+LMKILTERGYSF T
Sbjct: 145 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKL Y+
Sbjct: 205 TAEREIVR-DMKEKLSYI 221



 Score =  105 bits (252), Expect = 4e-23
 Identities = 47/59 (79%), Positives = 53/59 (89%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDE ++K
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497
           Actin 12 {Arabidopsis thaliana}
          Length = 377

 Score =  183 bits (446), Expect = 1e-46
 Identities = 84/85 (98%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNTPAMYVAIQAVLSL 144



 Score =  124 bits (299), Expect = 8e-29
 Identities = 62/78 (79%), Positives = 65/78 (83%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTD+LMKILTERGYSF T
Sbjct: 145 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKL Y+
Sbjct: 205 TAEREIVR-DMKEKLSYI 221



 Score =  105 bits (252), Expect = 4e-23
 Identities = 47/59 (79%), Positives = 53/59 (89%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDE ++K
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to
           SP|P53492 Actin 7 (Actin-2) {Arabidopsis thaliana}
          Length = 377

 Score =  182 bits (442), Expect = 4e-46
 Identities = 83/85 (97%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  121 bits (292), Expect = 5e-28
 Identities = 62/78 (79%), Positives = 63/78 (80%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTD LMKILTERGY F T
Sbjct: 145 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKL YV
Sbjct: 205 TAEREIVR-DIKEKLAYV 221



 Score =  105 bits (252), Expect = 4e-23
 Identities = 47/59 (79%), Positives = 53/59 (89%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDE ++K
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 377

 Score =  181 bits (441), Expect = 5e-46
 Identities = 81/85 (95%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN+PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNSPAMYVAIQAVLSL 144



 Score =  120 bits (289), Expect = 1e-27
 Identities = 60/78 (76%), Positives = 64/78 (82%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEG++LPHAILRLD +   LTDYLMKILTERGY F T
Sbjct: 145 YASGRTTGIVLDSGDGVSHTVPIYEGFSLPHAILRLDLAGRDLTDYLMKILTERGYMFTT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKL +V
Sbjct: 205 TAEREIVR-DIKEKLSFV 221



 Score =  101 bits (241), Expect = 8e-22
 Identities = 43/59 (72%), Positives = 52/59 (88%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGDE ++K
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSK 63


>At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 371

 Score =  181 bits (441), Expect = 5e-46
 Identities = 81/85 (95%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN+PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNSPAMYVAIQAVLSL 144



 Score =  120 bits (289), Expect = 1e-27
 Identities = 60/78 (76%), Positives = 64/78 (82%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEG++LPHAILRLD +   LTDYLMKILTERGY F T
Sbjct: 145 YASGRTTGIVLDSGDGVSHTVPIYEGFSLPHAILRLDLAGRDLTDYLMKILTERGYMFTT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKL +V
Sbjct: 205 TAEREIVR-DIKEKLSFV 221



 Score =  101 bits (241), Expect = 8e-22
 Identities = 43/59 (72%), Positives = 52/59 (88%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGDE ++K
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSK 63


>At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293
           Actin 8 {Arabidopsis thaliana}; nearly identical to
           SP|Q96292 Actin 2 [Arabidopsis thaliana] GI:1669387, and
           to At3g18780
          Length = 377

 Score =  181 bits (441), Expect = 5e-46
 Identities = 81/85 (95%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN+PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNSPAMYVAIQAVLSL 144



 Score =  120 bits (289), Expect = 1e-27
 Identities = 60/78 (76%), Positives = 64/78 (82%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEG++LPHAILRLD +   LTDYLMKILTERGY F T
Sbjct: 145 YASGRTTGIVLDSGDGVSHTVPIYEGFSLPHAILRLDLAGRDLTDYLMKILTERGYMFTT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKL +V
Sbjct: 205 TAEREIVR-DIKEKLSFV 221



 Score =  101 bits (241), Expect = 8e-22
 Identities = 43/59 (72%), Positives = 52/59 (88%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGDE ++K
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSK 63


>At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493
           Actin 3 {Arabidopsis thaliana}; supported by full-length
           cDNA: Ceres: 19581.
          Length = 377

 Score =  181 bits (440), Expect = 6e-46
 Identities = 82/85 (96%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNAPAMYVAIQAVLSL 144



 Score =  126 bits (305), Expect = 1e-29
 Identities = 63/78 (80%), Positives = 65/78 (83%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTD LMKILTERGYSF T
Sbjct: 145 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCY+
Sbjct: 205 TAEREIVR-DIKEKLCYI 221



 Score =  105 bits (252), Expect = 4e-23
 Identities = 47/59 (79%), Positives = 53/59 (89%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDE ++K
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671
           Actin 1 (Actin 3) {Arabidopsis thaliana}
          Length = 377

 Score =  181 bits (440), Expect = 6e-46
 Identities = 82/85 (96%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNAPAMYVAIQAVLSL 144



 Score =  126 bits (305), Expect = 1e-29
 Identities = 63/78 (80%), Positives = 65/78 (83%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTD LMKILTERGYSF T
Sbjct: 145 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCY+
Sbjct: 205 TAEREIVR-DIKEKLCYI 221



 Score =  105 bits (252), Expect = 4e-23
 Identities = 47/59 (79%), Positives = 53/59 (89%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDE ++K
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>At2g42100.1 68415.m05205 actin, putative very strong similarity to
           SP|P53496 Actin 11 {Arabidopsis thaliana}, SP|P53493
           Actin 3 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 378

 Score =  163 bits (396), Expect = 1e-40
 Identities = 70/85 (82%), Positives = 80/85 (94%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQ++RGIL+LKYPIEHG+V+NWDDMEKIWHHTFYNELR+ PEEHP+LLTEAPLNPK NRE
Sbjct: 61  AQARRGILSLKYPIEHGVVSNWDDMEKIWHHTFYNELRLEPEEHPILLTEAPLNPKVNRE 120

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFE+F  P+MY+ IQAVLSL
Sbjct: 121 KMTQIMFESFAFPSMYIGIQAVLSL 145



 Score =  120 bits (288), Expect = 2e-27
 Identities = 57/78 (73%), Positives = 65/78 (83%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           Y+SGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LT+YL KI+ ERGY++ T
Sbjct: 146 YSSGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTEYLTKIMMERGYTYTT 205

Query: 689 NAXREIRS*TFKEKLCYV 742
           +A REI     KEKLCY+
Sbjct: 206 SAEREIVR-DIKEKLCYI 222



 Score =   99 bits (238), Expect = 2e-21
 Identities = 43/59 (72%), Positives = 53/59 (89%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +E  A+V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH+GVMVGM +KD++VGDE +A+
Sbjct: 6   DESVAIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHRGVMVGMDEKDTFVGDEAQAR 64


>At2g42170.1 68415.m05219 actin, putative similar to actin 2
           [Arabidopsis thaliana] gi|9293903|dbj|BAB01806
          Length = 329

 Score =  156 bits (378), Expect = 2e-38
 Identities = 67/85 (78%), Positives = 79/85 (92%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           A+++ GILTL YP+EHG+V+NWDDMEKIW+HTFY+ELRVAPEEHPVLLTEAPLNPKA+RE
Sbjct: 15  AEARSGILTLDYPMEHGVVSNWDDMEKIWYHTFYSELRVAPEEHPVLLTEAPLNPKADRE 74

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETF  P+MY+ +QA LSL
Sbjct: 75  KMTQIMFETFAVPSMYIGMQAALSL 99



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 50/78 (64%), Positives = 59/78 (75%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           +ASGRTTG VLDSGDGVS+ VPIYEG ALPHAILRLD +   LT+YLMKI+ ERGY   T
Sbjct: 100 HASGRTTGTVLDSGDGVSYIVPIYEGSALPHAILRLDLAGRHLTNYLMKIMMERGY---T 156

Query: 689 NAXREIRS*TFKEKLCYV 742
           +A RE+     KE+  Y+
Sbjct: 157 SAEREVVR-DIKEQFGYI 173


>At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Actin
           11 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 366

 Score =  151 bits (365), Expect = 8e-37
 Identities = 71/100 (71%), Positives = 80/100 (80%)
 Frame = +3

Query: 210 RDGRYGTEGLLCRR*AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP 389
           RDG    E  +      + R ILTLK P+EHGIV NWDDMEKIWH+TFYNELRV PEEHP
Sbjct: 35  RDGLNPNESYVGEE-GHANRDILTLKDPMEHGIVNNWDDMEKIWHYTFYNELRVDPEEHP 93

Query: 390 VLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           VLLTEAP NPKANREKMTQIMFE+F+ PAMYV++Q+VL L
Sbjct: 94  VLLTEAPYNPKANREKMTQIMFESFDVPAMYVSMQSVLYL 133



 Score =  113 bits (272), Expect = 1e-25
 Identities = 53/78 (67%), Positives = 63/78 (80%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           Y+SGRTTG+VLD G+ VSHTVP+YEGYALPH ILRLD     LTDYL++I+TERGY++ T
Sbjct: 134 YSSGRTTGVVLDLGERVSHTVPVYEGYALPHGILRLDLGGRDLTDYLIEIMTERGYTYTT 193

Query: 689 NAXREIRS*TFKEKLCYV 742
           +A REI     KEKLCYV
Sbjct: 194 SAEREIVR-DIKEKLCYV 210



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 28/53 (52%), Positives = 36/53 (67%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRA 264
           +V D G GM +AGFAGD+AP+ VFP +VGRPR      G+   +SYVG+E  A
Sbjct: 4   IVCDKGHGMVQAGFAGDEAPKVVFPCVVGRPRD-----GLNPNESYVGEEGHA 51


>At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly
           identical to actin-related protein 2 (ARP2) [Arabidopsis
           thaliana] GI:3818624; contains Pfam profile PF00022:
           Actin
          Length = 389

 Score =  104 bits (250), Expect = 7e-23
 Identities = 42/78 (53%), Positives = 57/78 (73%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L + YP+ +GIV NWDDME +W H FYNEL++ P +  +LLT+ PLNP  NREKM + MF
Sbjct: 66  LDINYPVHNGIVQNWDDMEHVWDHAFYNELKINPSDCKILLTDPPLNPSKNREKMIETMF 125

Query: 456 ETFNTPAMYVAIQAVLSL 509
           E +N   +++ IQAVL+L
Sbjct: 126 EKYNFAGVFIQIQAVLTL 143



 Score = 78.2 bits (184), Expect = 7e-15
 Identities = 36/79 (45%), Positives = 52/79 (65%), Gaps = 1/79 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA G  TG+V+DSGDGV+H VP+ +GY+ PH   R++ +   +T YL+ +L+ RGY+   
Sbjct: 144 YAQGLLTGLVIDSGDGVTHVVPVVDGYSFPHLTKRMNVAGRHITAYLVDLLSRRGYAMNK 203

Query: 689 NAXRE-IRS*TFKEKLCYV 742
            A  E +R    KEKLCY+
Sbjct: 204 TADFETVRE--IKEKLCYI 220



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 23/51 (45%), Positives = 34/51 (66%), Gaps = 2/51 (3%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGD 252
           +V DNG+G  K GFAG++ P +VFP +VGRP  R++  ++    KD  VG+
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLRYEESLMEQQVKDIVVGE 57


>At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identical
           to actin-related protein 3 (ARP3) [Arabidopsis thaliana]
           GI:21427461; contains Pfam profile PF00022: Actin
          Length = 427

 Score = 94.7 bits (225), Expect = 7e-20
 Identities = 40/76 (52%), Positives = 53/76 (69%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 461
           L YPIEHG V +WD ME+ W    +N LR  PE+H  LLTE+PL P  +RE   +I+FET
Sbjct: 86  LHYPIEHGQVEDWDAMERYWQQCIFNYLRCDPEDHYFLLTESPLTPPESREYTGEILFET 145

Query: 462 FNTPAMYVAIQAVLSL 509
           FN P +Y+A+ +VL+L
Sbjct: 146 FNVPGLYIAVNSVLAL 161



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 24/79 (30%), Positives = 42/79 (53%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREI 706
           TG+V+D GDG +H VP+ EGY +   I  +  +   +T ++ +++ ERG +       ++
Sbjct: 173 TGVVVDVGDGATHVVPVAEGYVIGSCIKSIPIAGKDVTLFIQQLMRERGENIPPEDSFDV 232

Query: 707 RS*TFKEKLCYVGS*LSKQ 763
                KE  CY  S + K+
Sbjct: 233 AR-KVKEMYCYTCSDIVKE 250



 Score = 35.9 bits (79), Expect = 0.034
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 189
           A+V+DNG+G  K GFAG+  P  + P++V
Sbjct: 8   AIVIDNGTGYTKMGFAGNVEPCFILPTVV 36


>At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary
           identical to actin-related protein 4 (ARP4) [Arabidopsis
           thaliana] GI:21427463; contains Pfam profile PF00022:
           Actin; supporting cDNA gi|21427462|gb|AF507912.1|
          Length = 441

 Score = 80.2 bits (189), Expect = 2e-15
 Identities = 34/81 (41%), Positives = 53/81 (65%)
 Frame = +3

Query: 264 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 443
           +R  + +  PI+ GIV++WD ++ IW H F + L + P EHP+LL E PLN +  REK  
Sbjct: 85  RRDHMEVLSPIKDGIVSDWDLVDNIWEHAFKSCLMIDPTEHPMLLAEPPLNTQQQREKAA 144

Query: 444 QIMFETFNTPAMYVAIQAVLS 506
           ++MFE +  PA+++A   VL+
Sbjct: 145 ELMFEKYKVPALFMAKNPVLT 165



 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 23/34 (67%), Positives = 31/34 (91%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS++G
Sbjct: 5   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIG 38



 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 20/56 (35%), Positives = 33/56 (58%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERG 673
           ++A+GR T +V+D G G +   P+++GY L  A++        LTD L+K L  +G
Sbjct: 166 SFATGRATSLVVDCGGGSTTISPVHDGYVLQKAVVSSPLGGEFLTDCLLKSLESKG 221


>At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identical
           to actin-related protein 7 (ARP7) [Arabidopsis thaliana]
           GI:21427469; contains Pfam profile PF00022: Actin
          Length = 363

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQIMFETFN 467
           PIE G++ +WD ME +  +  Y  L      E  +L T+    PKA RE++ Q+MFETFN
Sbjct: 57  PIERGLIRDWDAMEDLLRYVVYTGLGWEEGNEGNILFTDPLCTPKAIREQLVQLMFETFN 116

Query: 468 TPAMYVAIQAVLSL 509
               Y + QAVLSL
Sbjct: 117 VSGFYASEQAVLSL 130


>At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identical
           to actin-related protein 5 (ARP5) GI:21489922 from
           [Arabidopsis thaliana]
          Length = 145

 Score = 62.9 bits (146), Expect = 3e-10
 Identities = 26/58 (44%), Positives = 37/58 (63%)
 Frame = +3

Query: 264 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 437
           +R  + +  P + GIVT+WD ++ +W H F N L + P EHP+LL E PLN +  REK
Sbjct: 79  RRDQMEILSPTKDGIVTDWDMVDNVWDHAFRNCLMIDPTEHPMLLAEPPLNSQQQREK 136



 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 24/34 (70%), Positives = 31/34 (91%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS+VG
Sbjct: 5   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVG 38


>At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly
           identical to actin-related protein 6 (ARP6) [Arabidopsis
           thaliana] GI:21427467; contains Pfam profile PF00022:
           Actin
          Length = 421

 Score = 54.8 bits (126), Expect = 7e-08
 Identities = 24/69 (34%), Positives = 41/69 (59%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 461
           ++ PI+ G + N D   +IW H F + L +AP    +LLTEAPL+  + +    +++FE 
Sbjct: 61  VRRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDELVFED 120

Query: 462 FNTPAMYVA 488
           F   ++Y+A
Sbjct: 121 FGFSSLYIA 129



 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 28/98 (28%), Positives = 46/98 (46%)
 Frame = +2

Query: 449 HVRNIQHARHVRRHPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSR 628
           H +++ H     R P   L   S     +V+D G   +H VP+   + L HAI R+D   
Sbjct: 130 HPQSLVHLYEASRQPDSIL---SKTQCSLVVDCGFSFTHAVPVLHNFTLNHAIKRIDLGG 186

Query: 629 SRLTDYLMKILTERGYSFITNAXREIRS*TFKEKLCYV 742
              T+YL ++++ R  + +        +   KEKLC+V
Sbjct: 187 KAFTNYLKELVSYRSINVMDETFLVDDA---KEKLCFV 221



 Score = 32.7 bits (71), Expect = 0.32
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 198
           +V+DNG G+ KAG  G+  P  V P+ + +P
Sbjct: 5   VVLDNGGGLIKAGQGGERDPTTVIPNCLYKP 35


>At3g12380.1 68416.m01543 actin/actin-like family protein similar to
           SP|P53946 Actin-like protein ARP5 {Saccharomyces
           cerevisiae}; contains Pfam profile PF00022: Actin
          Length = 724

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 467
           P +  +V  ++ ME I  + F       +  +HP+L+TE   NP  +R KM +++FET+ 
Sbjct: 85  PFDSNVVYQFEIMEYILDYAFDRLGANGSGIDHPILITECACNPVQSRSKMAELLFETYG 144

Query: 468 TPAMYVAIQAVLS 506
            PA+   + A  S
Sbjct: 145 VPAVAFGVDAAFS 157



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 21/49 (42%), Positives = 31/49 (63%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 252
           +V+DNG+   + G+AG+  PR VF +IV RPRH+      G+  + VGD
Sbjct: 22  IVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKAT----GETVTIVGD 66



 Score = 32.7 bits (71), Expect = 0.32
 Identities = 19/71 (26%), Positives = 36/71 (50%)
 Frame = +2

Query: 530 GIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREIR 709
           GIVL  G   +H++P  +G  +     R +     +TDYL ++L+ + Y F ++     +
Sbjct: 171 GIVLCPGFTTTHSIPFVDGEPIYKGSSRTNIGGYHVTDYLKQLLSLK-YPFHSSRFTWEK 229

Query: 710 S*TFKEKLCYV 742
           +   K + CY+
Sbjct: 230 AEDLKLEHCYI 240


>At5g56180.2 68418.m07009 actin-related protein, putative (ARP8)
           strong similarity to actin-related protein 8A (ARP8)
           [Arabidopsis thaliana] GI:21427473; contains Pfam
           profile PF00022: Actin; supporting cDNA
           gi|21427470|gb|AF507916.1|
          Length = 387

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 1/79 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPH-AILRLDFSRSRLTDYLMKILTERGYSFI 685
           YA+ RT+GIV++ G  V   +PI  G  +    +  + F   +LT +L + + E   SF 
Sbjct: 245 YAARRTSGIVVNIGFQVITILPILHGKVMRQVGVEVIGFGALKLTGFLKEKMQENNISF- 303

Query: 686 TNAXREIRS*TFKEKLCYV 742
             +   +R  T KEKLCYV
Sbjct: 304 -QSLYTVR--TLKEKLCYV 319


>At5g56180.1 68418.m07008 actin-related protein, putative (ARP8)
           strong similarity to actin-related protein 8A (ARP8)
           [Arabidopsis thaliana] GI:21427473; contains Pfam
           profile PF00022: Actin; supporting cDNA
           gi|21427470|gb|AF507916.1|
          Length = 471

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 1/79 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPH-AILRLDFSRSRLTDYLMKILTERGYSFI 685
           YA+ RT+GIV++ G  V   +PI  G  +    +  + F   +LT +L + + E   SF 
Sbjct: 245 YAARRTSGIVVNIGFQVITILPILHGKVMRQVGVEVIGFGALKLTGFLKEKMQENNISF- 303

Query: 686 TNAXREIRS*TFKEKLCYV 742
             +   +R  T KEKLCYV
Sbjct: 304 -QSLYTVR--TLKEKLCYV 319


>At5g01040.1 68418.m00007 laccase family protein / diphenol oxidase
           family protein similar to laccase [Pinus
           taeda][GI:13661201], lac110 laccase, Populus
           trichocarpa, EMBL:PTY13773
          Length = 584

 Score = 33.9 bits (74), Expect = 0.14
 Identities = 19/46 (41%), Positives = 28/46 (60%)
 Frame = -3

Query: 227 PIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSS 90
           P P I P  RGL   +G T+  +SSPA+P + +P  +ST +  TS+
Sbjct: 290 PTPDIKP-TRGLIVYQGATS--SSSPAEPLMPVPNDMSTAHRFTSN 332


>At2g22470.1 68415.m02664 arabinogalactan-protein (AGP2) identical
           to gi|3883122|gb|AAC77824; supported by cDNA
           gi|3883121|gb|AF082299
          Length = 131

 Score = 31.9 bits (69), Expect = 0.56
 Identities = 17/58 (29%), Positives = 26/58 (44%)
 Frame = +3

Query: 522 VPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           +PPV+  TP+ ++  P P    T +PT S   +      QT +    PSA      +P
Sbjct: 38  LPPVTAETPSPIASPPVPVNEPTPAPTTSPTTSPVASPPQTDAPAPGPSAGLTPTSSP 95


>At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid
           transfer protein (LTP) family protein similar to
           SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein
           Lycopersicon esculentum, proline-rich cell wall protein
           [Medicago sativa] GI:3818416; contains Pfam profile
           PF00234 Protease inhibitor/seed storage/LTP family
          Length = 334

 Score = 31.5 bits (68), Expect = 0.74
 Identities = 19/62 (30%), Positives = 23/62 (37%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLP 689
           T PVV P +   P    PTP P      +PTP  +          T    +P   T   P
Sbjct: 171 TPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTP 230

Query: 690 TP 695
           TP
Sbjct: 231 TP 232



 Score = 28.3 bits (60), Expect = 6.9
 Identities = 13/35 (37%), Positives = 16/35 (45%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCV 614
           T PV+ P +   P    PTP P      +PTP  V
Sbjct: 201 TPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVV 235



 Score = 27.9 bits (59), Expect = 9.1
 Identities = 12/32 (37%), Positives = 15/32 (46%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTP 605
           T PV+ P +   P    PTP P      +PTP
Sbjct: 211 TPPVITPPTPTPPVVTPPTPTPPVVTPPTPTP 242


>At3g19430.1 68416.m02464 late embryogenesis abundant
           protein-related / LEA protein-related similar to late
           embryogenesis abundant protein [Picea glauca] GI:1350543
          Length = 559

 Score = 31.5 bits (68), Expect = 0.74
 Identities = 18/38 (47%), Positives = 22/38 (57%)
 Frame = +3

Query: 495 AVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPS 608
           +V S T PV PP    TP+  SPTP P +    +PTPS
Sbjct: 89  SVPSPTPPVSPPPPTPTPSVPSPTP-PVSPPPPTPTPS 125



 Score = 31.5 bits (68), Expect = 0.74
 Identities = 18/38 (47%), Positives = 22/38 (57%)
 Frame = +3

Query: 495 AVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPS 608
           +V S T PV PP    TP+  SPTP P +    +PTPS
Sbjct: 107 SVPSPTPPVSPPPPTPTPSVPSPTP-PVSPPPPTPTPS 143



 Score = 31.5 bits (68), Expect = 0.74
 Identities = 18/38 (47%), Positives = 22/38 (57%)
 Frame = +3

Query: 495 AVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPS 608
           +V S T PV PP    TP+  SPTP P +    +PTPS
Sbjct: 125 SVPSPTPPVSPPPPTPTPSVPSPTP-PVSPPPPTPTPS 161



 Score = 30.3 bits (65), Expect = 1.7
 Identities = 17/37 (45%), Positives = 19/37 (51%)
 Frame = +3

Query: 495 AVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTP 605
           +V S T PV PP    TP+  SPTP   T    SP P
Sbjct: 143 SVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPP 179


>At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical to
           protodermal factor 1 [Arabidopsis thaliana]
           gi|4929130|gb|AAD33869
          Length = 306

 Score = 31.1 bits (67), Expect = 0.98
 Identities = 23/57 (40%), Positives = 26/57 (45%)
 Frame = +3

Query: 525 PPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           PP    TP+T S TP P T  +H+PTP       G      S    PS  T S PTP
Sbjct: 75  PPSHTPTPSTPSHTPTPHT-PSHTPTPHTPPCNCGSPPSHPSTPSHPS--TPSHPTP 128


>At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical to
           protodermal factor 1 [Arabidopsis thaliana]
           gi|4929130|gb|AAD33869
          Length = 306

 Score = 31.1 bits (67), Expect = 0.98
 Identities = 23/57 (40%), Positives = 26/57 (45%)
 Frame = +3

Query: 525 PPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           PP    TP+T S TP P T  +H+PTP       G      S    PS  T S PTP
Sbjct: 75  PPSHTPTPSTPSHTPTPHT-PSHTPTPHTPPCNCGSPPSHPSTPSHPS--TPSHPTP 128


>At5g17420.1 68418.m02044 cellulose synthase, catalytic subunit
           (IRX3) identical to gi:5230423
          Length = 1026

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 3/39 (7%)
 Frame = +2

Query: 404 GSPQPQGQQREDDPDHVR---NIQHARHVRRHPSRALAY 511
           GSP+ +G + E+D D +    NI+H +   +H + A+ Y
Sbjct: 91  GSPRVEGDEDEEDIDDIEYEFNIEHEQDKHKHSAEAMLY 129


>At1g70080.1 68414.m08063 terpene synthase/cyclase family protein
           similar to (+)-delta-cadinene synthase [Gossypium
           hirsutum][GI:8389329], sesquiterpene synthases
           [GI:11934937][Lycopersicon hirsutum],
           [GI:11934933][Lycopersicon esculentum]; contains Pfam
           profile: PF01397: Terpene synthase family
          Length = 611

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 15/46 (32%), Positives = 23/46 (50%)
 Frame = +3

Query: 480 YVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVW 617
           Y  +++ LS +R   P   C   AT +PT   ST  + +P P  +W
Sbjct: 31  YPLLKSSLSFSRFQSPKKLCLVRATTNPTDDNSTTRSFTPHPPSLW 76


>At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein
           contains Pfam PF01422: NF-X1 type zinc finger; similar
           to transcriptional repressor NF-X1 (SP:Q12986) [Homo
           sapiens]; similar to EST gb|T21002
          Length = 1188

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 1/32 (3%)
 Frame = +3

Query: 519 VVPPVSCWTPATVSPTPCPSTRDT-HSPTPSC 611
           + PP+SC TP      PCP  +   HS T  C
Sbjct: 645 IPPPLSCGTPVPSCQLPCPIPQPCGHSDTHGC 676


>At4g27850.1 68417.m03999 proline-rich family protein contains
           proline-rich extensin domains, INTERPRO:IPR002965
          Length = 577

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 15/33 (45%), Positives = 16/33 (48%)
 Frame = +3

Query: 507 LTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTP 605
           L  P  PP S  TP   SP P P    + SPTP
Sbjct: 227 LPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTP 259


>At3g51050.1 68416.m05590 FG-GAP repeat-containing protein
          Length = 698

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 17/70 (24%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +2

Query: 479 VRRHPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKI 658
           +R H ++ +  A G    +++  G  +  ++ +       HA++  DFS   LTD +  +
Sbjct: 590 LRIHDNQPMILAGGDQAAVIISPGGSILASIELPSQPT--HALITDDFSNDGLTDVI--V 645

Query: 659 LTERG-YSFI 685
           +T  G Y F+
Sbjct: 646 MTSNGVYGFV 655


>At1g51090.1 68414.m05744 heavy-metal-associated domain-containing
           protein  contains Pfam profile PF00403:
           Heavy-metal-associated domain
          Length = 171

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 12/36 (33%), Positives = 15/36 (41%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVW 617
           T P   P     PA V P P P    + +P P  +W
Sbjct: 92  TAPAPAPAQAQAPALVRPAPVPVLVSSSAPQPMPMW 127


>At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family
           protein weak similarity to SP|Q00765 Polyposis locus
           protein 1 (TB2 protein) {Homo sapiens}; contains Pfam
           profile PF03134: TB2/DP1, HVA22 family
          Length = 315

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 20/74 (27%), Positives = 29/74 (39%)
 Frame = +3

Query: 387 PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPT 566
           P L+T+ P++PK       Q   +T    A     Q  L+   P  PP     P    P 
Sbjct: 191 PQLVTKEPISPKPLSSPRKQQQLQTETKEAKASVSQTKLTTLTPPGPP-----PPPPPPP 245

Query: 567 PCPSTRDTHSPTPS 608
           P P+T    +  P+
Sbjct: 246 PSPTTAAKRNADPA 259


>At1g16690.2 68414.m01999 transcription factor-related similar to
           enhancer of polycomb (GI:11907923)[Homo sapiens]
          Length = 439

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 18/54 (33%), Positives = 25/54 (46%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 437
           L++KY + H I + W +  +IW       L+  P   PV  T  P N    REK
Sbjct: 178 LSIKYGVFHAIYSYWKNKREIWQKPILRRLQPPP---PVNDTN-PYNVFRPREK 227


>At1g16690.1 68414.m01998 transcription factor-related similar to
           enhancer of polycomb (GI:11907923)[Homo sapiens]
          Length = 439

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 18/54 (33%), Positives = 25/54 (46%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 437
           L++KY + H I + W +  +IW       L+  P   PV  T  P N    REK
Sbjct: 178 LSIKYGVFHAIYSYWKNKREIWQKPILRRLQPPP---PVNDTN-PYNVFRPREK 227


>At4g13350.2 68417.m02088 human Rev interacting-like protein-related
           / hRIP protein-related similar to SP|P52594
           Nucleoporin-like protein RIP (HIV-1 Rev-binding protein)
           (Rev interacting protein) (Rev/Rex activation
           domain-binding protein) {Homo sapiens}; contains Pfam
           profile PF01412: Putative GTPase activating protein for
           Arf
          Length = 602

 Score = 28.3 bits (60), Expect = 6.9
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 4/61 (6%)
 Frame = +3

Query: 438 MTQIMFET-FNTPAMYVAIQAVLSLT-RPVVPPVSCWTP--ATVSPTPCPSTRDTHSPTP 605
           ++ I F+T F TPA  VAIQA LS T +P   P +      A+    P   + +   P P
Sbjct: 282 LSLIDFDTDFETPAPSVAIQAPLSTTSQPAPQPTTSSNDNWASFDAAPSAPSLNVSQPPP 341

Query: 606 S 608
           S
Sbjct: 342 S 342


>At4g13350.1 68417.m02087 human Rev interacting-like protein-related
           / hRIP protein-related similar to SP|P52594
           Nucleoporin-like protein RIP (HIV-1 Rev-binding protein)
           (Rev interacting protein) (Rev/Rex activation
           domain-binding protein) {Homo sapiens}; contains Pfam
           profile PF01412: Putative GTPase activating protein for
           Arf
          Length = 602

 Score = 28.3 bits (60), Expect = 6.9
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 4/61 (6%)
 Frame = +3

Query: 438 MTQIMFET-FNTPAMYVAIQAVLSLT-RPVVPPVSCWTP--ATVSPTPCPSTRDTHSPTP 605
           ++ I F+T F TPA  VAIQA LS T +P   P +      A+    P   + +   P P
Sbjct: 282 LSLIDFDTDFETPAPSVAIQAPLSTTSQPAPQPTTSSNDNWASFDAAPSAPSLNVSQPPP 341

Query: 606 S 608
           S
Sbjct: 342 S 342


>At1g02890.1 68414.m00256 AAA-type ATPase family protein contains
           Pfam domain, PF00004: ATPase, AAA family; similar to
           mitochondrial sorting protein 1 (MSP1) (TAT-binding
           homolog 4) (Swiss-Prot:P28737) [Saccharomyces
           cerevisiae]
          Length = 1252

 Score = 28.3 bits (60), Expect = 6.9
 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%)
 Frame = +1

Query: 526 HRYRAGLRRRCL-PHRAHLRGIRTPPRHPASG 618
           + ++AG R R L P  + L  +R PPR PA+G
Sbjct: 601 YTFKAGDRVRFLGPSTSSLASLRAPPRGPATG 632


>At5g18270.2 68418.m02148 no apical meristem (NAM) family protein
           contains Pfam PF02365 : No apical meristem (NAM)
           protein; similar to cup-shaped cotyledon CUC2
           (GI:1944132) [Arabidopsis thaliana]
          Length = 335

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 26/102 (25%), Positives = 43/102 (42%), Gaps = 2/102 (1%)
 Frame = +3

Query: 303 GIVTNW--DDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPA 476
           G  TNW   +      +++YN  + A +E  V       NP    + MT+I  E F    
Sbjct: 135 GEKTNWVMHEYRLEGKYSYYNLPKSARDEWVVCRVFHKNNPSTTTQPMTRIPVEDFTRMD 194

Query: 477 MYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPT 602
               I  +L  +   +PP+    P+ +S T  P+ +  + PT
Sbjct: 195 SLENIDHLLDFSS--LPPLI--DPSFMSQTEQPNFKPINPPT 232


>At5g18270.1 68418.m02147 no apical meristem (NAM) family protein
           contains Pfam PF02365 : No apical meristem (NAM)
           protein; similar to cup-shaped cotyledon CUC2
           (GI:1944132) [Arabidopsis thaliana]
          Length = 335

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 26/102 (25%), Positives = 43/102 (42%), Gaps = 2/102 (1%)
 Frame = +3

Query: 303 GIVTNW--DDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPA 476
           G  TNW   +      +++YN  + A +E  V       NP    + MT+I  E F    
Sbjct: 135 GEKTNWVMHEYRLEGKYSYYNLPKSARDEWVVCRVFHKNNPSTTTQPMTRIPVEDFTRMD 194

Query: 477 MYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPT 602
               I  +L  +   +PP+    P+ +S T  P+ +  + PT
Sbjct: 195 SLENIDHLLDFSS--LPPLI--DPSFMSQTEQPNFKPINPPT 232


>At3g28790.1 68416.m03593 expressed protein 
          Length = 608

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 1/23 (4%)
 Frame = +3

Query: 543 TPATVSP-TPCPSTRDTHSPTPS 608
           TP+T +P TP PST    +PTPS
Sbjct: 282 TPSTPTPSTPTPSTPTPSTPTPS 304


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,686,457
Number of Sequences: 28952
Number of extensions: 469832
Number of successful extensions: 1695
Number of sequences better than 10.0: 42
Number of HSP's better than 10.0 without gapping: 1458
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1665
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1989897600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -