SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30134.Seq
         (882 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g15680.1 68418.m01834 expressed protein                             29   3.1  
At2g40970.1 68415.m05060 myb family transcription factor contain...    29   3.1  
At5g53870.1 68418.m06701 plastocyanin-like domain-containing pro...    29   5.4  
At2g37580.1 68415.m04610 zinc finger (C3HC4-type RING finger) fa...    28   7.2  

>At5g15680.1 68418.m01834 expressed protein 
          Length = 2151

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 16/46 (34%), Positives = 24/46 (52%)
 Frame = +3

Query: 168  SRLRQSTVHSNEIGERQRSQRTGYESPG*LVRARVREGVPPPLCAG 305
            S + +   ++N++GE QRS+  GYE P         EGV P +  G
Sbjct: 1810 SSMPRDEFNTNDLGEFQRSESRGYEMPPSSGTLPKFEGVQPLVLKG 1855


>At2g40970.1 68415.m05060 myb family transcription factor contains
           Pfam profile: PF00249 myb-like DNA-binding domain
          Length = 248

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 23/81 (28%), Positives = 34/81 (41%), Gaps = 1/81 (1%)
 Frame = -3

Query: 499 IKMALKLXHIFLISKLFSKLPNL*RRNTLLSRHETASSSHRVANVXPVPAASKAHTGPAG 320
           I   L   H+ L  ++ S   +L  + T    H+   SS       P P     ++   G
Sbjct: 25  ISQTLITPHLALAFQIGSPNHHLGSKRTTAIYHQKLQSSTTPTTPTPTPPPMMMNSDFGG 84

Query: 319 G-ATHRPAHSGGGTPSRTLAR 260
           G +T   + S GG P+RTL R
Sbjct: 85  GDSTDLGSGSIGGEPARTLKR 105


>At5g53870.1 68418.m06701 plastocyanin-like domain-containing
           protein contains similarity to SP|Q02917 Early nodulin
           55-2 precursor {Glycine max}; PF02298: Plastocyanin-like
           domain
          Length = 370

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 1/55 (1%)
 Frame = -3

Query: 412 LSRHETASSSHRVANVXPVPAASKAHTGPAGGATHRPAHSGGGTPSRTLART-SH 251
           +S     S SH  ++    P+ S     P    +H P+HS   TPS + A T SH
Sbjct: 188 ISHTPALSPSHATSHSPATPSPSPKSPSPV---SHSPSHSPAHTPSHSPAHTPSH 239



 Score = 28.3 bits (60), Expect = 7.2
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 2/49 (4%)
 Frame = -3

Query: 391 SSSHRVANVXPVPAA-SKAHTGPAGGATHRPAHSGGGTPSRTLART-SH 251
           ++SH  A   P P + S     P+    H P+HS   TPS + A   SH
Sbjct: 199 ATSHSPATPSPSPKSPSPVSHSPSHSPAHTPSHSPAHTPSHSPAHAPSH 247



 Score = 28.3 bits (60), Expect = 7.2
 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 4/55 (7%)
 Frame = -3

Query: 403 HETASSSHRVANVXPV---PAASKAHTGPAGGATHRPAHSGGGTPSRTLART-SH 251
           H  A+ S    +  PV   P+ S AHT P+    H P+HS    PS + A   SH
Sbjct: 202 HSPATPSPSPKSPSPVSHSPSHSPAHT-PSHSPAHTPSHSPAHAPSHSPAHAPSH 255



 Score = 27.9 bits (59), Expect = 9.5
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
 Frame = -3

Query: 391 SSSHRVANVXPVPAASKAHTGPAGGATHRPAHSGGGTPSRTLART-SH 251
           S SH  A+    P+ S AHT P+    H P+HS    PS + A   SH
Sbjct: 220 SPSHSPAHT---PSHSPAHT-PSHSPAHAPSHSPAHAPSHSPAHAPSH 263


>At2g37580.1 68415.m04610 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type
          Length = 235

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 15/45 (33%), Positives = 20/45 (44%)
 Frame = -3

Query: 427 RRNTLLSRHETASSSHRVANVXPVPAASKAHTGPAGGATHRPAHS 293
           RRN+  SR  ++S     A V   P      T  +GG  H+  HS
Sbjct: 91  RRNSSSSRTSSSSDDTPHATVDTPPITETTVTSESGGKFHKDTHS 135


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,009,377
Number of Sequences: 28952
Number of extensions: 394120
Number of successful extensions: 914
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 871
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 912
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 2077687200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -