SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30132.Seq
         (689 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g19610.2 68415.m02291 zinc finger (C3HC4-type RING finger) fa...    31   0.72 
At2g19610.1 68415.m02290 zinc finger (C3HC4-type RING finger) fa...    31   0.72 
At5g06970.1 68418.m00789 expressed protein                             29   2.9  
At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-conta...    29   3.8  
At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-conta...    29   3.8  
At2g13800.1 68415.m01523 leucine-rich repeat family protein / pr...    29   3.8  
At1g43000.1 68414.m04950 zinc-binding family protein similar to ...    28   5.1  
At4g01740.1 68417.m00226 DC1 domain-containing protein similar t...    28   6.7  
At5g62480.2 68418.m07842 glutathione S-transferase, putative           27   8.9  
At5g62480.1 68418.m07841 glutathione S-transferase, putative           27   8.9  
At3g45620.1 68416.m04927 transducin family protein / WD-40 repea...    27   8.9  
At1g67520.1 68414.m07692 lectin protein kinase family protein co...    27   8.9  

>At2g19610.2 68415.m02291 zinc finger (C3HC4-type RING finger)
           family protein contains a zinc finger, C3HC4 type (RING
           finger), signature, PROSITE:PS00518
          Length = 418

 Score = 31.1 bits (67), Expect = 0.72
 Identities = 15/65 (23%), Positives = 34/65 (52%)
 Frame = +1

Query: 364 SSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRPTSTSAMVK 543
           +S++   EG+T+   C  C   ++ N+K E+ +  FH  C  C     + +P S+  +++
Sbjct: 188 ASQTRWCEGDTEYESCPVCYAYVSPNDKFEV-QGCFHRICVTC-----MRKPFSSEQILR 241

Query: 544 SSASL 558
            + ++
Sbjct: 242 GNTAI 246


>At2g19610.1 68415.m02290 zinc finger (C3HC4-type RING finger)
           family protein contains a zinc finger, C3HC4 type (RING
           finger), signature, PROSITE:PS00518
          Length = 397

 Score = 31.1 bits (67), Expect = 0.72
 Identities = 15/65 (23%), Positives = 34/65 (52%)
 Frame = +1

Query: 364 SSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRPTSTSAMVK 543
           +S++   EG+T+   C  C   ++ N+K E+ +  FH  C  C     + +P S+  +++
Sbjct: 188 ASQTRWCEGDTEYESCPVCYAYVSPNDKFEV-QGCFHRICVTC-----MRKPFSSEQILR 241

Query: 544 SSASL 558
            + ++
Sbjct: 242 GNTAI 246


>At5g06970.1 68418.m00789 expressed protein
          Length = 1101

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +2

Query: 290 LSTQTGPSGLVESLEMVRRGIILEQAANQRPLKGILNA 403
           +S     SGLV  LEM+R  + + +A + R  +G+LNA
Sbjct: 245 VSQSQSSSGLVSLLEMMRGQMEISEAMDIRTRQGLLNA 282


>At5g37380.2 68418.m04492 DNAJ heat shock N-terminal
           domain-containing protein similar to SP|Q9QYI4 DnaJ
           homolog subfamily B member 12 {Mus musculus}; contains
           Pfam profile PF00226: DnaJ domain
          Length = 431

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 17/57 (29%), Positives = 29/57 (50%)
 Frame = +1

Query: 361 ASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRPTSTS 531
           AS  S+ S+ NT  +VC RC+ M  E  ++ ++      +C + Y    V +P  +S
Sbjct: 229 ASGSSDQSKSNTFWTVCRRCM-MQYEYLRVYVNCNLRCPNCLQSYLAVEVPKPGISS 284


>At5g37380.1 68418.m04491 DNAJ heat shock N-terminal
           domain-containing protein similar to SP|Q9QYI4 DnaJ
           homolog subfamily B member 12 {Mus musculus}; contains
           Pfam profile PF00226: DnaJ domain
          Length = 431

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 17/57 (29%), Positives = 29/57 (50%)
 Frame = +1

Query: 361 ASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRPTSTS 531
           AS  S+ S+ NT  +VC RC+ M  E  ++ ++      +C + Y    V +P  +S
Sbjct: 229 ASGSSDQSKSNTFWTVCRRCM-MQYEYLRVYVNCNLRCPNCLQSYLAVEVPKPGISS 284


>At2g13800.1 68415.m01523 leucine-rich repeat family protein /
           protein kinase family protein contains Pfam domains
           PF00560: Leucine Rich Repeat and PF00069: Protein kinase
           domain
          Length = 601

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 21/68 (30%), Positives = 32/68 (47%)
 Frame = +1

Query: 172 LHVLRLQNNSVGGEDVLRARILQWMLQAHVLDRFRGECPSVHTNWAQWTCGKFGNGQEGD 351
           L  LRL NNS+ GE       L   +     +R  G+ P V+ +++Q+T   F N +   
Sbjct: 144 LRFLRLYNNSLSGEIPRSLTALPLDVLDISNNRLSGDIP-VNGSFSQFTSMSFANNKLRP 202

Query: 352 NPGASSKS 375
            P + S S
Sbjct: 203 RPASPSPS 210


>At1g43000.1 68414.m04950 zinc-binding family protein similar to
           zinc-binding protein [Pisum sativum] GI:16117799;
           contains Pfam profile PF04640 : Protein of unknown
           function, DUF597
          Length = 216

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 9/18 (50%), Positives = 9/18 (50%)
 Frame = +3

Query: 531 CYGQVFCEPCFQHHVLHR 584
           C G  FC  C  HH  HR
Sbjct: 42  CSGNAFCSSCLAHHRTHR 59


>At4g01740.1 68417.m00226 DC1 domain-containing protein similar to
           T15B16.6 similar to A. thaliana CHP-rich hypothetical
           proteins encoded by T10M13, GenBank accession number
           AF001308
          Length = 652

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 221 YGHVFCNGCFK 253
           YG +FCNGC+K
Sbjct: 470 YGKIFCNGCYK 480


>At5g62480.2 68418.m07842 glutathione S-transferase, putative
          Length = 214

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 9/28 (32%), Positives = 18/28 (64%)
 Frame = +2

Query: 5   RYYSNFISIHTYPKKSSLIMDKGQEQVK 88
           R+++N+I +H Y     ++  +G+EQ K
Sbjct: 74  RFWANYIQLHLYDLVIKVVKSEGEEQKK 101


>At5g62480.1 68418.m07841 glutathione S-transferase, putative
          Length = 240

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 9/28 (32%), Positives = 18/28 (64%)
 Frame = +2

Query: 5   RYYSNFISIHTYPKKSSLIMDKGQEQVK 88
           R+++N+I +H Y     ++  +G+EQ K
Sbjct: 100 RFWANYIQLHLYDLVIKVVKSEGEEQKK 127


>At3g45620.1 68416.m04927 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats;  similar to
           PC326 protein  (GI:200241) (PIR2:S37694) [Mus
           musculus];Human (H326) translated mRNA - Homo sapiens,
           EMBL:HS06631
          Length = 481

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 17/45 (37%), Positives = 23/45 (51%)
 Frame = +1

Query: 82  SQKAILCSMFFTCGF*RHH*NSRAKLSSNLLHVLRLQNNSVGGED 216
           S   +L S  FT G  RHH +SR +L+S  +        +VGG D
Sbjct: 178 SATMVLYSSPFTQGCRRHHSSSRIRLNSIAIDPRNSYYLAVGGSD 222


>At1g67520.1 68414.m07692 lectin protein kinase family protein
           contains Pfam domains PF00069: Protein kinase domain and
           PF01453: Lectin (probable mannose binding)
          Length = 587

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 11/29 (37%), Positives = 16/29 (55%)
 Frame = -2

Query: 688 TILAQPINCFIFSANLGSANCSKHCLKNS 602
           T+ +   N F+ S    S +CS  CL+NS
Sbjct: 310 TVSSSASNGFVLSGTFSSVDCSAICLQNS 338


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,600,653
Number of Sequences: 28952
Number of extensions: 328685
Number of successful extensions: 1000
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 964
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1000
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1467502800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -