SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30131.Seq
         (482 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g72370.1 68414.m08371 40S ribosomal protein SA (RPSaA) identi...   113   6e-26
At3g04770.2 68416.m00514 40S ribosomal protein SA (RPSaB) identi...   111   2e-25
At3g04770.1 68416.m00513 40S ribosomal protein SA (RPSaB) identi...   111   2e-25
At2g07020.1 68415.m00803 protein kinase family protein contains ...    30   0.94 
At4g26490.1 68417.m03812 expressed protein                             28   3.8  
At2g40050.1 68415.m04921 DC1 domain-containing protein contains ...    28   3.8  
At3g54570.1 68416.m06038 calmodulin-binding protein-related cont...    27   6.6  
At3g24810.1 68416.m03113 kip-related protein 5 (KRP5) / cyclin-d...    27   6.6  
At2g02640.1 68415.m00203 DC1 domain-containing protein   contain...    27   8.8  

>At1g72370.1 68414.m08371 40S ribosomal protein SA (RPSaA) identical
           to laminin receptor-like protein GB:U01955 [Arabidopsis
           thaliana]; identical to cDNA laminin receptor homologue
           GI:16379
          Length = 298

 Score =  113 bits (272), Expect = 6e-26
 Identities = 53/82 (64%), Positives = 63/82 (76%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL +AAR +VAIENP D+ V S+R +GQRAVLKFA +TGA  IAGR TPG FTNQ+Q +F
Sbjct: 61  KLQMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSF 120

Query: 183 REPRLLIVLDPAQXHQPITEAS 248
            EPRLLI+ DP   HQPI E +
Sbjct: 121 SEPRLLILTDPRTDHQPIKEGA 142



 Score = 86.6 bits (205), Expect = 8e-18
 Identities = 36/74 (48%), Positives = 48/74 (64%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IP+IA C+TDSP+ FVDI IP N K  HSIG ++W                Q WDV+VDL
Sbjct: 146 IPIIAFCDTDSPMRFVDIGIPANNKGKHSIGCLFWLLARMVLQMRGTIAAGQKWDVMVDL 205

Query: 437 FFYRDPEESEKDEQ 478
           FFYR+PEE++ +++
Sbjct: 206 FFYREPEETKPEDE 219


>At3g04770.2 68416.m00514 40S ribosomal protein SA (RPSaB) identical
           to p40 protein homolog GB:AAB67866 [Arabidopsis
           thaliana]; similar to 40S ribosomal protein SA (P40)
           GB:O65751 [Cicer arietinum]
          Length = 280

 Score =  111 bits (268), Expect = 2e-25
 Identities = 52/82 (63%), Positives = 62/82 (75%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL +AAR +VAIENP D+ V S+R +GQRAVLKFA +TG   IAGR TPG FTNQ+Q +F
Sbjct: 62  KLQMAARVIVAIENPKDIIVQSARPYGQRAVLKFAQYTGVNAIAGRHTPGTFTNQMQTSF 121

Query: 183 REPRLLIVLDPAQXHQPITEAS 248
            EPRLLI+ DP   HQPI E +
Sbjct: 122 SEPRLLILTDPRTDHQPIKEGA 143



 Score = 83.4 bits (197), Expect = 7e-17
 Identities = 36/72 (50%), Positives = 46/72 (63%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IP IA C+TDSP+ FVDI IP N K  HSIG ++W                Q WDV+VDL
Sbjct: 147 IPTIAFCDTDSPMGFVDIGIPANNKGKHSIGCLFWLLARMVLQMRGTILAAQKWDVMVDL 206

Query: 437 FFYRDPEESEKD 472
           FFYR+PEE++++
Sbjct: 207 FFYREPEEAKQE 218


>At3g04770.1 68416.m00513 40S ribosomal protein SA (RPSaB) identical
           to p40 protein homolog GB:AAB67866 [Arabidopsis
           thaliana]; similar to 40S ribosomal protein SA (P40)
           GB:O65751 [Cicer arietinum]
          Length = 332

 Score =  111 bits (268), Expect = 2e-25
 Identities = 52/82 (63%), Positives = 62/82 (75%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL +AAR +VAIENP D+ V S+R +GQRAVLKFA +TG   IAGR TPG FTNQ+Q +F
Sbjct: 62  KLQMAARVIVAIENPKDIIVQSARPYGQRAVLKFAQYTGVNAIAGRHTPGTFTNQMQTSF 121

Query: 183 REPRLLIVLDPAQXHQPITEAS 248
            EPRLLI+ DP   HQPI E +
Sbjct: 122 SEPRLLILTDPRTDHQPIKEGA 143



 Score = 60.5 bits (140), Expect = 6e-10
 Identities = 27/59 (45%), Positives = 33/59 (55%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVD 433
           IP IA C+TDSP+ FVDI IP N K  HSIG ++W                Q WDV+V+
Sbjct: 147 IPTIAFCDTDSPMGFVDIGIPANNKGKHSIGCLFWLLARMVLQMRGTILAAQKWDVMVN 205


>At2g07020.1 68415.m00803 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 700

 Score = 29.9 bits (64), Expect = 0.94
 Identities = 14/34 (41%), Positives = 17/34 (50%)
 Frame = +3

Query: 144 TPGAFTNQIQAAFREPRLLIVLDPAQXHQPITEA 245
           TP   TNQ++ A  E     +LDP     PI EA
Sbjct: 620 TPMGLTNQVEKAIEEGNFAKILDPLVTDWPIEEA 653


>At4g26490.1 68417.m03812 expressed protein 
          Length = 200

 Score = 27.9 bits (59), Expect = 3.8
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = -2

Query: 193 RGSRNAAWIWLVKAPGVKRPAIGVAPVXAANFST 92
           R SR + WIW V      RP I V  +  AN  T
Sbjct: 29  RSSRTSLWIWCVAVFLAIRPRIPVFDIPNANLHT 62


>At2g40050.1 68415.m04921 DC1 domain-containing protein contains
           Pfam profile PF03107: DC1 domain
          Length = 609

 Score = 27.9 bits (59), Expect = 3.8
 Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 3/53 (5%)
 Frame = +2

Query: 146 TRCFY*PDPSCIP*TSSLDCI---GPCTXPSTHY*SFICXIPVIAXCNTDSPL 295
           T+ FY  +  C   T  ++C+    P   P  ++  ++C + V+  CN   PL
Sbjct: 533 TKVFYWCNECCT--TFHIECLIGGDPYIKPGQYFNKWVCRVQVLPKCNISRPL 583


>At3g54570.1 68416.m06038 calmodulin-binding protein-related
           contains similarity to potato calmodulin-binding protein
           PCBP GI:17933110 from [Solanum tuberosum]
          Length = 417

 Score = 27.1 bits (57), Expect = 6.6
 Identities = 9/15 (60%), Positives = 12/15 (80%)
 Frame = -2

Query: 343 RVGRLGVAWDSNVHK 299
           R GR+G  WD+NVH+
Sbjct: 107 RSGRIGRCWDANVHR 121


>At3g24810.1 68416.m03113 kip-related protein 5 (KRP5) /
           cyclin-dependent kinase inhibitor 5 (ICK5) identical to 
           cyclin-dependent kinase inhibitor 5 (krp5) [Arabidopsis
           thaliana] GI:14422293
          Length = 189

 Score = 27.1 bits (57), Expect = 6.6
 Identities = 15/40 (37%), Positives = 20/40 (50%)
 Frame = -1

Query: 167 LVSKSTWCETSRNRRSTGVXGKLQYSTLTEGP**DDEHIS 48
           L+     C+T   R S+G   KL+  T TE    D+E IS
Sbjct: 79  LIPSVNQCQTKNPRASSGPAKKLEPDTTTEEACGDNERIS 118


>At2g02640.1 68415.m00203 DC1 domain-containing protein   contains
           Pfam profile PF03107: DC1 domain
          Length = 627

 Score = 26.6 bits (56), Expect = 8.8
 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%)
 Frame = -1

Query: 212 VQYNQETRF-TECSLDLVSKSTWCETSRNRRSTG 114
           V+Y  +  + T C  D VS S WCE    + S G
Sbjct: 510 VRYKHDEHYLTFCHGDEVSDSDWCELCEGKLSIG 543


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,145,445
Number of Sequences: 28952
Number of extensions: 191767
Number of successful extensions: 390
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 373
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 388
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 829097472
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -