SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30125.Seq
         (682 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g52240.1 68418.m06484 cytochrome b5 domain-containing protein...    83   2e-16
At3g48890.1 68416.m05341 cytochrome b5 domain-containing protein...    82   3e-16
At2g24940.1 68415.m02982 cytochrome b5 domain-containing protein...    74   8e-14
At4g14965.1 68417.m02300 cytochrome b5 domain-containing protein...    64   6e-11
At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family...    33   0.17 
At3g56140.1 68416.m06240 expressed protein At2g40400 - Arabidops...    31   0.71 
At1g35080.1 68414.m04347 hypothetical protein                          30   1.6  
At5g36060.1 68418.m04344 hypothetical protein                          29   2.2  
At3g26260.1 68416.m03276 Ulp1 protease family protein contains P...    29   2.8  
At5g14920.1 68418.m01750 gibberellin-regulated family protein si...    29   3.8  
At5g56890.1 68418.m07099 protein kinase family protein contains ...    28   6.6  
At3g53570.3 68416.m05915 protein kinase (AFC1) (AME2) identical ...    28   6.6  
At3g53570.2 68416.m05916 protein kinase (AFC1) (AME2) identical ...    28   6.6  
At3g53570.1 68416.m05917 protein kinase (AFC1) (AME2) identical ...    28   6.6  
At3g44750.1 68416.m04817 histone deacetylase, putative (HD2A) co...    24   7.9  
At5g60640.2 68418.m07611 thioredoxin family protein similar to p...    27   8.7  
At5g60640.1 68418.m07610 thioredoxin family protein similar to p...    27   8.7  

>At5g52240.1 68418.m06484 cytochrome b5 domain-containing protein
           similar to SP|P70580 Membrane associated progesterone
           receptor component 1 {Rattus norvegicus}; contains Pfam
           profile PF00173: Heme/Steroid binding domain
          Length = 220

 Score = 83.0 bits (196), Expect = 2e-16
 Identities = 40/85 (47%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           +T  EL+QYDG+     +LMA+   I+DVT+   FYGPGGPYA+F G+DA+R LA  S  
Sbjct: 75  ITEEELKQYDGSDPQKPLLMAIKHQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSF- 133

Query: 435 APEKDYD-DLSDLNSMEMESVREWE 506
             EKD   D+S L   E++++++WE
Sbjct: 134 -EEKDLTWDVSGLGPFELDALQDWE 157


>At3g48890.1 68416.m05341 cytochrome b5 domain-containing protein
           similar to SP|O00264 Membrane associated progesterone
           receptor component (mPR) {Homo sapiens}; contains Pfam
           profile PF00173: Heme/Steroid binding domain
          Length = 233

 Score = 82.2 bits (194), Expect = 3e-16
 Identities = 37/84 (44%), Positives = 56/84 (66%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           +T  EL+ YDG+     +LMA+ G I+DV++   FYGPGGPYA+F G+DA+R LA  S  
Sbjct: 71  ITEEELKLYDGSDSKKPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFE 130

Query: 435 APEKDYDDLSDLNSMEMESVREWE 506
             +    D+S L + E+E++++WE
Sbjct: 131 DQDLT-GDISGLGAFELEALQDWE 153


>At2g24940.1 68415.m02982 cytochrome b5 domain-containing protein
           similar to SP|P70580 Membrane associated progesterone
           receptor component 1 {Rattus norvegicus}; contains Pfam
           profile PF00173: Heme/Steroid binding domain
          Length = 100

 Score = 74.1 bits (174), Expect = 8e-14
 Identities = 36/88 (40%), Positives = 51/88 (57%), Gaps = 1/88 (1%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTA 437
           TA +L QY+GT E   + +A+ G +FDVT G  FYG GG Y++F G+DA+R L   S   
Sbjct: 4   TAEQLSQYNGTDESKPIYVAIKGRVFDVTTGKSFYGSGGDYSMFAGKDASRALGKMSKN- 62

Query: 438 PEKDYD-DLSDLNSMEMESVREWEDNLE 518
            E+D    L  L   E+ ++ +WE   E
Sbjct: 63  -EEDVSPSLEGLTEKEINTLNDWETKFE 89


>At4g14965.1 68417.m02300 cytochrome b5 domain-containing protein
           similar to SP|O15173 Membrane associated progesterone
           receptor component 2 (Steroid receptor protein DG6)
           {Homo sapiens}; contains Pfam profile PF00173:
           Heme/Steroid binding domain
          Length = 245

 Score = 64.5 bits (150), Expect = 6e-11
 Identities = 35/86 (40%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +3

Query: 249 KRM-TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATF 425
           KR+ +A EL  Y+GT E   +L+ + G +FDVT+G   YG GG Y  F GRDA+R   + 
Sbjct: 39  KRLFSAEELALYNGTDETLPILLGILGSVFDVTKGKFHYGSGGGYNHFAGRDASRAFVSG 98

Query: 426 SVTAPEKDYDDLSDLNSMEMESVREW 503
           + T  +   D L  L+S E++S+ +W
Sbjct: 99  NFTG-DGLTDSLQGLSSSEVKSIVDW 123


>At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family
           protein contains proline-rich extensin domains,
           INTERPRO:IPR002965
          Length = 473

 Score = 33.1 bits (72), Expect = 0.17
 Identities = 15/52 (28%), Positives = 26/52 (50%)
 Frame = -1

Query: 418 ASPLVASLPPKTAYGPPGP*NRFPLVTSNIHPFTAINTLPPSCVPSYCRSST 263
           + PL+ +L P +++  P   N  P + S  HP       PP  +P++  SS+
Sbjct: 249 SQPLIKNLTPPSSFSSPRKSNPIPNLASEFHPSPPPPPPPPPPLPAFYNSSS 300


>At3g56140.1 68416.m06240 expressed protein At2g40400 - Arabidopsis
           thaliana, EMBL:AC007020
          Length = 745

 Score = 31.1 bits (67), Expect = 0.71
 Identities = 20/52 (38%), Positives = 23/52 (44%)
 Frame = -1

Query: 466 SLKSS*SFSGAVTENVASPLVASLPPKTAYGPPGP*NRFPLVTSNIHPFTAI 311
           SL S  S S  VT    S      P  T   PP P N+   +TS I+  TAI
Sbjct: 88  SLASEESSSATVTSPAESAAPPPPPATTTPSPPPPVNKEETITSRIYDATAI 139


>At1g35080.1 68414.m04347 hypothetical protein
          Length = 386

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 3/39 (7%)
 Frame = +2

Query: 230 KNYLNCEKNDRSRTTAVRR---DTGGWQSVDGCEWVDIR 337
           K  L+C + DRSR++       + GGW  +DG  W   R
Sbjct: 75  KETLSCVRLDRSRSSLWMEPYGEDGGWVQIDGAYWAQPR 113


>At5g36060.1 68418.m04344 hypothetical protein
          Length = 165

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 16/43 (37%), Positives = 21/43 (48%)
 Frame = +2

Query: 287 DTGGWQSVDGCEWVDIRCD*RESVLRSRWAICCFWRKRCHKRT 415
           + GGW  +DG  W   R   RES+ R     C   + R HKR+
Sbjct: 125 EDGGWVQIDGAYWAQPRV--RESIPR-----CSRCKSRAHKRS 160


>At3g26260.1 68416.m03276 Ulp1 protease family protein contains Pfam
           profile PF02902: Ulp1 protease family, C-terminal
           catalytic domain
          Length = 989

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = +3

Query: 438 PEKDYDDLSDLNSMEMESVREWEDNLERIMIWSVD 542
           PE D DD SD+   + E  R W   L+  ++W VD
Sbjct: 250 PEVDEDDDSDMEETQKEIERLWSLKLD--IVWKVD 282


>At5g14920.1 68418.m01750 gibberellin-regulated family protein
           similar to SP|P46689 Gibberellin-regulated protein 1
           precursor {Arabidopsis thaliana}; contains Pfam profile
           PF02704: Gibberellin regulated protein
          Length = 275

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%)
 Frame = -1

Query: 430 TENVASPLVASLPPKTAYGPPGP*NRFP-LVTSNIHPFTAINTLPPSCVP 284
           T  + SP  A+ PP  A  PP P  + P L T+ I P T    + P  +P
Sbjct: 35  TPTLPSPSPATKPPSPALKPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIP 84


>At5g56890.1 68418.m07099 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 1113

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 18/42 (42%), Positives = 20/42 (47%), Gaps = 2/42 (4%)
 Frame = -1

Query: 445 FSGAVTENVASPLVASLP--PKTAYGPPGP*NRFPLVTSNIH 326
           FSG VT    S  V+ +P  P  A  PP P N  P   SN H
Sbjct: 145 FSGRVTPAPVSSPVSDIPPIPSVALPPPTPSNVPPRNASNNH 186


>At3g53570.3 68416.m05915 protein kinase (AFC1) (AME2) identical to
           protein kinase AFC1 (EC 2.7.1.-) [Arabidopsis thaliana]
          Length = 453

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%)
 Frame = -1

Query: 433 VTENVASPLVASLPPKTAYGPP---GP*NRFPLVTSNIHPFTAINTLPPSCVPSY 278
           +T + A PL+   PP T + PP   GP     LV + ++P    N LP    P +
Sbjct: 26  LTWDAAPPLLPPPPPPTVFQPPLYYGPEFASGLVPNFVYPNMFYNGLPRQGSPPW 80


>At3g53570.2 68416.m05916 protein kinase (AFC1) (AME2) identical to
           protein kinase AFC1 (EC 2.7.1.-) [Arabidopsis thaliana]
          Length = 467

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%)
 Frame = -1

Query: 433 VTENVASPLVASLPPKTAYGPP---GP*NRFPLVTSNIHPFTAINTLPPSCVPSY 278
           +T + A PL+   PP T + PP   GP     LV + ++P    N LP    P +
Sbjct: 40  LTWDAAPPLLPPPPPPTVFQPPLYYGPEFASGLVPNFVYPNMFYNGLPRQGSPPW 94


>At3g53570.1 68416.m05917 protein kinase (AFC1) (AME2) identical to
           protein kinase AFC1 (EC 2.7.1.-) [Arabidopsis thaliana]
          Length = 467

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%)
 Frame = -1

Query: 433 VTENVASPLVASLPPKTAYGPP---GP*NRFPLVTSNIHPFTAINTLPPSCVPSY 278
           +T + A PL+   PP T + PP   GP     LV + ++P    N LP    P +
Sbjct: 40  LTWDAAPPLLPPPPPPTVFQPPLYYGPEFASGLVPNFVYPNMFYNGLPRQGSPPW 94


>At3g44750.1 68416.m04817 histone deacetylase, putative (HD2A)
           contains Pfam domain, PF00096: Zinc finger, C2H2 type;
           identical to cDNA  putative histone deacetylase (HD2A)
           GI:11066134
          Length = 245

 Score = 24.2 bits (50), Expect(2) = 7.9
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = +2

Query: 551 PGEEPRNYSDEEPEEAD 601
           P  EP+ YS+EE EE +
Sbjct: 95  PNIEPQGYSEEEEEEEE 111



 Score = 21.8 bits (44), Expect(2) = 7.9
 Identities = 6/20 (30%), Positives = 13/20 (65%)
 Frame = +2

Query: 578 DEEPEEADTSALPNDDKENQ 637
           D+E +E+D+  +  DD + +
Sbjct: 137 DDEEDESDSDGMDEDDSDGE 156


>At5g60640.2 68418.m07611 thioredoxin family protein similar to
           protein disulfide isomerase GI:5902592 from [Volvox
           carteri f. nagariensis], GI:2708314 from Chlamydomonas
           reinhardtii; contains Pfam profile: PF00085 Thioredoxin
          Length = 536

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = +2

Query: 557 EEPRNYSDEEPEEADTSALPNDDKE 631
           E+P  Y+D++ EE D S L N D +
Sbjct: 69  EDPDMYNDDDDEEGDFSDLGNPDSD 93


>At5g60640.1 68418.m07610 thioredoxin family protein similar to
           protein disulfide isomerase GI:5902592 from [Volvox
           carteri f. nagariensis], GI:2708314 from Chlamydomonas
           reinhardtii; contains Pfam profile: PF00085 Thioredoxin
          Length = 597

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = +2

Query: 557 EEPRNYSDEEPEEADTSALPNDDKE 631
           E+P  Y+D++ EE D S L N D +
Sbjct: 69  EDPDMYNDDDDEEGDFSDLGNPDSD 93


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,275,482
Number of Sequences: 28952
Number of extensions: 332036
Number of successful extensions: 1081
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 1013
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1077
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1438152744
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -