SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30124.Seq
         (669 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g13580.3 68416.m01710 60S ribosomal protein L7 (RPL7D) simila...    93   2e-19
At3g13580.2 68416.m01709 60S ribosomal protein L7 (RPL7D) simila...    93   2e-19
At3g13580.1 68416.m01708 60S ribosomal protein L7 (RPL7D) simila...    93   2e-19
At2g44120.2 68415.m05488 60S ribosomal protein L7 (RPL7C)              91   5e-19
At2g44120.1 68415.m05487 60S ribosomal protein L7 (RPL7C)              91   5e-19
At2g01250.1 68415.m00037 60S ribosomal protein L7 (RPL7B)              89   3e-18
At1g80750.1 68414.m09474 60S ribosomal protein L7 (RPL7A) simila...    45   4e-05
At5g25950.1 68418.m03085 hypothetical protein various predicted ...    31   0.52 
At3g52860.1 68416.m05825 expressed protein                             31   0.92 
At5g45310.1 68418.m05562 expressed protein                             28   4.9  
At5g06740.1 68418.m00762 lectin protein kinase family protein co...    27   8.5  
At3g59970.3 68416.m06695 methylenetetrahydrofolate reductase 1 (...    27   8.5  
At1g26540.1 68414.m03234 agenet domain-containing protein contai...    27   8.5  

>At3g13580.3 68416.m01710 60S ribosomal protein L7 (RPL7D) similar
           to 60S ribosomal protein L7 GB:AAD14525 GI:4262232 from
           [Arabidopsis thaliana]
          Length = 244

 Score = 93.1 bits (221), Expect = 2e-19
 Identities = 47/104 (45%), Positives = 65/104 (62%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           + +K+LQL RLRQI NGVF+++NKAT+NMLR  EPY+ +GYPNLKSV+EL+         
Sbjct: 100 KTKKILQLLRLRQIFNGVFLKVNKATINMLRRVEPYVTYGYPNLKSVKELIYKRGFGKLN 159

Query: 535 DNVYQSLPTALLRRGSINTTLSVLRTFIHEIFTVGEKFKYASNF 666
                    +++ +G     +  +   IHEI TVG  FK A+NF
Sbjct: 160 HQRTALTDNSIVDQGLGKHGIICVEDLIHEIMTVGPHFKEANNF 203



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G +YV  EAKL F+IRIRGIN + PK+ K    L
Sbjct: 75  GGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLL 108



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 22/63 (34%), Positives = 32/63 (50%)
 Frame = +3

Query: 66  DSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKER 245
           +++    VPESVLK             Q     +    +K++ IF RA+QY KEY+ KER
Sbjct: 3   EAESKTVVPESVLKKRKREEEWALAKKQELEAAKKQNAEKRKLIFNRAKQYSKEYQEKER 62

Query: 246 DEI 254
           + I
Sbjct: 63  ELI 65


>At3g13580.2 68416.m01709 60S ribosomal protein L7 (RPL7D) similar
           to 60S ribosomal protein L7 GB:AAD14525 GI:4262232 from
           [Arabidopsis thaliana]
          Length = 244

 Score = 93.1 bits (221), Expect = 2e-19
 Identities = 47/104 (45%), Positives = 65/104 (62%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           + +K+LQL RLRQI NGVF+++NKAT+NMLR  EPY+ +GYPNLKSV+EL+         
Sbjct: 100 KTKKILQLLRLRQIFNGVFLKVNKATINMLRRVEPYVTYGYPNLKSVKELIYKRGFGKLN 159

Query: 535 DNVYQSLPTALLRRGSINTTLSVLRTFIHEIFTVGEKFKYASNF 666
                    +++ +G     +  +   IHEI TVG  FK A+NF
Sbjct: 160 HQRTALTDNSIVDQGLGKHGIICVEDLIHEIMTVGPHFKEANNF 203



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G +YV  EAKL F+IRIRGIN + PK+ K    L
Sbjct: 75  GGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLL 108



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 22/63 (34%), Positives = 32/63 (50%)
 Frame = +3

Query: 66  DSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKER 245
           +++    VPESVLK             Q     +    +K++ IF RA+QY KEY+ KER
Sbjct: 3   EAESKTVVPESVLKKRKREEEWALAKKQELEAAKKQNAEKRKLIFNRAKQYSKEYQEKER 62

Query: 246 DEI 254
           + I
Sbjct: 63  ELI 65


>At3g13580.1 68416.m01708 60S ribosomal protein L7 (RPL7D) similar
           to 60S ribosomal protein L7 GB:AAD14525 GI:4262232 from
           [Arabidopsis thaliana]
          Length = 244

 Score = 93.1 bits (221), Expect = 2e-19
 Identities = 47/104 (45%), Positives = 65/104 (62%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           + +K+LQL RLRQI NGVF+++NKAT+NMLR  EPY+ +GYPNLKSV+EL+         
Sbjct: 100 KTKKILQLLRLRQIFNGVFLKVNKATINMLRRVEPYVTYGYPNLKSVKELIYKRGFGKLN 159

Query: 535 DNVYQSLPTALLRRGSINTTLSVLRTFIHEIFTVGEKFKYASNF 666
                    +++ +G     +  +   IHEI TVG  FK A+NF
Sbjct: 160 HQRTALTDNSIVDQGLGKHGIICVEDLIHEIMTVGPHFKEANNF 203



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G +YV  EAKL F+IRIRGIN + PK+ K    L
Sbjct: 75  GGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLL 108



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 22/63 (34%), Positives = 32/63 (50%)
 Frame = +3

Query: 66  DSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKER 245
           +++    VPESVLK             Q     +    +K++ IF RA+QY KEY+ KER
Sbjct: 3   EAESKTVVPESVLKKRKREEEWALAKKQELEAAKKQNAEKRKLIFNRAKQYSKEYQEKER 62

Query: 246 DEI 254
           + I
Sbjct: 63  ELI 65


>At2g44120.2 68415.m05488 60S ribosomal protein L7 (RPL7C) 
          Length = 247

 Score = 91.5 bits (217), Expect = 5e-19
 Identities = 47/104 (45%), Positives = 64/104 (61%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           + +K+LQL RLRQI NGVF+++NKATVNMLR  EPY+ +GYPNLKSV+EL+         
Sbjct: 103 KTKKILQLLRLRQIFNGVFLKVNKATVNMLRRVEPYVTYGYPNLKSVKELIYKRGYGKLN 162

Query: 535 DNVYQSLPTALLRRGSINTTLSVLRTFIHEIFTVGEKFKYASNF 666
                    +++ +      +  +   IHEI TVG  FK A+NF
Sbjct: 163 HQRIALTDNSIVDQALGKHGIICVEDLIHEIMTVGPHFKEANNF 206



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G +YV  EAKL F+IRIRGIN + PK+ K    L
Sbjct: 78  GGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLL 111



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 20/56 (35%), Positives = 29/56 (51%)
 Frame = +3

Query: 87  VPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEI 254
           VPESVLK                +  +  +++ ++ IFKRAEQY KEY  K+ + I
Sbjct: 13  VPESVLKKIKRQEEWALAKKDEAVAAKKKSVEARKLIFKRAEQYAKEYAEKDNELI 68


>At2g44120.1 68415.m05487 60S ribosomal protein L7 (RPL7C) 
          Length = 242

 Score = 91.5 bits (217), Expect = 5e-19
 Identities = 47/104 (45%), Positives = 64/104 (61%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           + +K+LQL RLRQI NGVF+++NKATVNMLR  EPY+ +GYPNLKSV+EL+         
Sbjct: 98  KTKKILQLLRLRQIFNGVFLKVNKATVNMLRRVEPYVTYGYPNLKSVKELIYKRGYGKLN 157

Query: 535 DNVYQSLPTALLRRGSINTTLSVLRTFIHEIFTVGEKFKYASNF 666
                    +++ +      +  +   IHEI TVG  FK A+NF
Sbjct: 158 HQRIALTDNSIVDQALGKHGIICVEDLIHEIMTVGPHFKEANNF 201



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G +YV  EAKL F+IRIRGIN + PK+ K    L
Sbjct: 73  GGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLL 106



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 20/56 (35%), Positives = 29/56 (51%)
 Frame = +3

Query: 87  VPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEI 254
           VPESVLK                +  +  +++ ++ IFKRAEQY KEY  K+ + I
Sbjct: 8   VPESVLKKIKRQEEWALAKKDEAVAAKKKSVEARKLIFKRAEQYAKEYAEKDNELI 63


>At2g01250.1 68415.m00037 60S ribosomal protein L7 (RPL7B)
          Length = 242

 Score = 88.6 bits (210), Expect = 3e-18
 Identities = 45/104 (43%), Positives = 63/104 (60%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           + +K+LQL RLRQI NGVF+++NKAT+NMLR  EPY+ +G+PNLKSV+EL+         
Sbjct: 98  KTKKILQLLRLRQIFNGVFLKVNKATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKLN 157

Query: 535 DNVYQSLPTALLRRGSINTTLSVLRTFIHEIFTVGEKFKYASNF 666
                    +++ +      +      IHEI TVG  FK A+NF
Sbjct: 158 HQRIALTDNSIVEQALGKHGIICTEDLIHEILTVGPHFKEANNF 201



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G +YV  EAKL F+IRIRGIN + PK+ K    L
Sbjct: 73  GGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLL 106



 Score = 37.9 bits (84), Expect = 0.006
 Identities = 22/56 (39%), Positives = 28/56 (50%)
 Frame = +3

Query: 87  VPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEI 254
           VPESVLK             Q     +    + ++ IFKRAEQY KEY  KE++ I
Sbjct: 8   VPESVLKKRKREEEWALEKKQNVEAAKKKNAENRKLIFKRAEQYSKEYAEKEKELI 63


>At1g80750.1 68414.m09474 60S ribosomal protein L7 (RPL7A) similar
           to ribosomal protein L7 GB:AAA03081 GI:307388 from [Homo
           sapiens]
          Length = 247

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 23/104 (22%), Positives = 47/104 (45%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           + +++L   +L+ +  GVF +   +    L   +PY+ +GYPN KSV++L+         
Sbjct: 102 KTKRILNNLQLKSVFTGVFAKATDSLFQKLLKVQPYVTYGYPNDKSVKDLIYKKGCTIIE 161

Query: 535 DNVYQSLPTALLRRGSINTTLSVLRTFIHEIFTVGEKFKYASNF 666
            N        ++ +      +  +   ++EI  VG+ F+    F
Sbjct: 162 GNPVPLTDNNIIEQALGEHKILGIEDLVNEIARVGDHFREVMRF 205



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 49/197 (24%), Positives = 79/197 (40%), Gaps = 12/197 (6%)
 Frame = +3

Query: 60  KEDSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIK 239
           +E++K L  +PE VLK             +      S   KKK    KR E +V E+R K
Sbjct: 3   EEEAKGLDYIPEIVLKKRKNRDELAFIRKKQLELGNSGKKKKKVSDIKRPEDFVHEFRAK 62

Query: 240 ERDEI------------D*PDKHAIVATTTFPGKPNWHLSSESVVSTKFHRSP*SSATV* 383
           E D I              P K  +V      GK + H  ++ +++    +S  +     
Sbjct: 63  EVDMIRMKQRVKRPKSSPPPVKSDLVFIIRIQGKNDMHPKTKRILNNLQLKSVFTGVFAK 122

Query: 384 TAPNKQWCVCTSE*GYCEYATYRRALHCLGIPQLKECP*VSIKRGFAKLSGQRIPITSNS 563
              +    +   +     Y TY       G P  K    +  K+G   + G  +P+T N+
Sbjct: 123 ATDSLFQKLLKVQ----PYVTY-------GYPNDKSVKDLIYKKGCTIIEGNPVPLTDNN 171

Query: 564 IVEKRLHKHNIICVEDL 614
           I+E+ L +H I+ +EDL
Sbjct: 172 IIEQALGEHKILGIEDL 188



 Score = 28.3 bits (60), Expect = 4.9
 Identities = 12/29 (41%), Positives = 19/29 (65%)
 Frame = +2

Query: 296 PGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           P ++ L F+IRI+G N + PK+ +  N L
Sbjct: 82  PVKSDLVFIIRIQGKNDMHPKTKRILNNL 110


>At5g25950.1 68418.m03085 hypothetical protein various predicted
           proteins, Arabidopsis thaliana contains Pfam profile
           PF03080: Arabidopsis proteins of unknown function
          Length = 413

 Score = 31.5 bits (68), Expect = 0.52
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 3/70 (4%)
 Frame = -2

Query: 668 GKLLAYLNFSPTVKISWMKVLNTDNVVFMEPLLNNAVGSDWYTLSTQLGESTFDTNSRT- 492
           G L  YL  S T  + W   +++ NVV  +P    A+GS  +  S    E+ F TN R  
Sbjct: 307 GTLFNYLKHSATA-VQWGGEVHSPNVVLKKPHTTTAMGSGQWA-SYIWAEACFHTNLRIK 364

Query: 491 --LFKLGYPQ 468
               +L YPQ
Sbjct: 365 DYSMQLKYPQ 374


>At3g52860.1 68416.m05825 expressed protein 
          Length = 156

 Score = 30.7 bits (66), Expect = 0.92
 Identities = 13/38 (34%), Positives = 23/38 (60%)
 Frame = +3

Query: 144 LQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEID 257
           ++  LK +   IKK   +F+ +++ VKE   K RDE++
Sbjct: 117 MEEELKTKDELIKKHMRLFQESQKLVKEQIEKHRDELE 154


>At5g45310.1 68418.m05562 expressed protein
          Length = 352

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 12/29 (41%), Positives = 19/29 (65%)
 Frame = +3

Query: 186 KREIFKRAEQYVKEYRIKERDEID*PDKH 272
           ++EI K   + +KEYRI E+D  +  D+H
Sbjct: 107 RKEIEKNLREAIKEYRIMEQDLDELEDEH 135


>At5g06740.1 68418.m00762 lectin protein kinase family protein
           contains Legume lectins beta-chain signature,
           PROSITE:PS00307 and Serine/Threonine protein kinases
           active-site signature, PROSITE:PS00108
          Length = 652

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = +1

Query: 310 IGICHPNPWYQPSFTEVRKVL 372
           +  CHPNP  +PS   V KVL
Sbjct: 586 LACCHPNPNQRPSMKTVLKVL 606


>At3g59970.3 68416.m06695 methylenetetrahydrofolate reductase 1
           (MTHFR1) identical to methylenetetrahydrofolate
           reductase MTHFR1 [Arabidopsis thaliana] GI:5911425
          Length = 592

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%)
 Frame = +1

Query: 310 IGICHPNPWYQPSFTEVRKVLQLFRLRQINNGVFVRLN-KATVNMLRIAEPYIAWGYP 480
           IG    +PW +    +    +   +L +IN+  F+ +N + +VN  +   P I WG P
Sbjct: 403 IGNLKSSPWSELDGLQPETKIINEQLGKINSNGFLTINSQPSVNAAKSDSPAIGWGGP 460


>At1g26540.1 68414.m03234 agenet domain-containing protein contains
           Pfam PF05641: Agenet domain
          Length = 695

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%)
 Frame = -1

Query: 387 QSKQLQNFTDF-GETWLIPRIRMTNANLASPGT 292
           + KQL+    + G TW+ P I  +N ++ SPGT
Sbjct: 126 ERKQLRTHLIWTGGTWIQPEIEESNKSMFSPGT 158


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,406,420
Number of Sequences: 28952
Number of extensions: 272687
Number of successful extensions: 702
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 657
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 689
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1412971776
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -