SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30123.Seq
         (694 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g20890.1 68417.m03029 tubulin beta-9 chain (TUB9) nearly iden...   150   7e-37
At2g29550.1 68415.m03589 tubulin beta-7 chain (TUB7) identical t...   150   7e-37
At1g20010.1 68414.m02506 tubulin beta-5 chain (TUB5) nearly iden...   150   7e-37
At1g75780.1 68414.m08801 tubulin beta-1 chain (TUB1) nearly iden...   149   2e-36
At5g23860.1 68418.m02801 tubulin beta-8 chain (TUB8) (TUBB8) ide...   149   2e-36
At5g44340.1 68418.m05429 tubulin beta-4 chain (TUB4) nearly iden...   148   4e-36
At5g12250.1 68418.m01439 tubulin beta-6 chain (TUB6) nearly iden...   147   5e-36
At5g62700.1 68418.m07868 tubulin beta-2/beta-3 chain (TUB3) near...   146   9e-36
At5g62690.1 68418.m07867 tubulin beta-2/beta-3 chain (TUB2) near...   146   9e-36
At5g19780.1 68418.m02351 tubulin alpha-3/alpha-5 chain (TUA5) ne...    87   1e-17
At5g19770.1 68418.m02350 tubulin alpha-3/alpha-5 chain (TUA3) ne...    87   1e-17
At4g14960.2 68417.m02299 tubulin alpha-6 chain (TUA6) nearly ide...    87   1e-17
At4g14960.1 68417.m02298 tubulin alpha-6 chain (TUA6) nearly ide...    87   1e-17
At1g50010.1 68414.m05612 tubulin alpha-2/alpha-4 chain (TUA2) id...    87   1e-17
At1g04820.1 68414.m00478 tubulin alpha-2/alpha-4 chain (TUA4) ne...    87   1e-17
At1g64740.1 68414.m07340 tubulin alpha-1 chain (TUA1) nearly ide...    84   1e-16
At5g05620.1 68418.m00612 tubulin gamma-2 chain / gamma-2 tubulin...    60   1e-09
At3g61650.1 68416.m06909 tubulin gamma-1 chain / gamma-1 tubulin...    60   1e-09
At4g37190.1 68417.m05265 expressed protein                             30   1.3  
At1g66050.1 68414.m07497 zinc finger (C3HC4-type RING finger) fa...    29   3.9  
At1g52430.1 68414.m05919 ubiquitin carboxyl-terminal hydrolase-r...    29   3.9  
At5g62120.1 68418.m07797 hypothetical protein                          28   5.1  
At3g49900.1 68416.m05455 BTB/POZ domain-containing protein conta...    28   6.8  
At3g31910.1 68416.m04037 hypothetical protein                          28   6.8  
At5g64790.1 68418.m08146 glycosyl hydrolase family 17 protein si...    27   8.9  
At5g37175.1 68418.m04463 hypothetical protein                          27   8.9  

>At4g20890.1 68417.m03029 tubulin beta-9 chain (TUB9) nearly
           identical to SP|P29517 Tubulin beta-9 chain {Arabidopsis
           thaliana}
          Length = 444

 Score =  150 bits (364), Expect = 7e-37
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVY+NEAS GKYVPR VL+DL+P TMD++RSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYFNEASGGKYVPRAVLMDLEPGTMDSLRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   V  +              +   +  P  
Sbjct: 103 KGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F  F  P+    VVEPYN TL
Sbjct: 163 MMMTFSVFPSPKVSDTVVEPYNATL 187



 Score = 64.9 bits (151), Expect = 5e-11
 Identities = 28/42 (66%), Positives = 33/42 (78%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVI  EHGID +G   GD+DL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVICGEHGIDQTGQSCGDTDL 42



 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 26/51 (50%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = +2

Query: 509 DCLQVFR-CHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+ CH+              +++IREEYPDR+++TFSVFPSP+VSD
Sbjct: 128 DCLQGFQVCHS-LGGGTGSGMGTLLISKIREEYPDRMMMTFSVFPSPKVSD 177


>At2g29550.1 68415.m03589 tubulin beta-7 chain (TUB7) identical to
           GB:M84704 SP|P29515 Tubulin beta-7 chain {Arabidopsis
           thaliana}
          Length = 449

 Score =  150 bits (364), Expect = 7e-37
 Identities = 74/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLER+NVYYNEAS G+YVPR VL+DL+P TMD+VRSGP+G +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERVNVYYNEASCGRYVPRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   V  +              +   +  P  
Sbjct: 103 KGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F  F  P+    VVEPYN TL
Sbjct: 163 MMMTFSVFPSPKVSDTVVEPYNATL 187



 Score = 67.3 bits (157), Expect = 9e-12
 Identities = 28/42 (66%), Positives = 35/42 (83%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEV++ EHGID +G Y GDS+L
Sbjct: 1   MREILHIQGGQCGNQIGSKFWEVVNLEHGIDQTGRYVGDSEL 42



 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 26/51 (50%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = +2

Query: 509 DCLQVFR-CHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+ CH+              +++IREEYPDR+++TFSVFPSP+VSD
Sbjct: 128 DCLQGFQVCHS-LGGGTGSGMGTLLISKIREEYPDRMMMTFSVFPSPKVSD 177


>At1g20010.1 68414.m02506 tubulin beta-5 chain (TUB5) nearly
           identical to SP|P29513 Tubulin beta-5 chain {Arabidopsis
           thaliana}
          Length = 449

 Score =  150 bits (364), Expect = 7e-37
 Identities = 74/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEAS G+YVPR VL+DL+P TMD++RSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 44  QLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPFGQIFRPDNFVFGQSGAGNNWA 103

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++++ LDV+R+EAE     +   V  +              +   +  P  
Sbjct: 104 KGHYTEGAELIDAVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDR 163

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F  F  P+    VVEPYN TL
Sbjct: 164 MMLTFSVFPSPKVSDTVVEPYNATL 188



 Score = 68.1 bits (159), Expect = 5e-12
 Identities = 28/40 (70%), Positives = 33/40 (82%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDS 249
           MREI+++Q G CGNQIG KFWEVI DEHGID +G Y GD+
Sbjct: 1   MREILHIQGGQCGNQIGSKFWEVICDEHGIDSTGRYSGDT 40



 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = +2

Query: 509 DCLQVFR-CHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+ CH+              +++IREEYPDR++LTFSVFPSP+VSD
Sbjct: 129 DCLQGFQVCHS-LGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSD 178


>At1g75780.1 68414.m08801 tubulin beta-1 chain (TUB1) nearly
           identical to SP|P12411 Tubulin beta-1 chain {Arabidopsis
           thaliana}
          Length = 447

 Score =  149 bits (361), Expect = 2e-36
 Identities = 73/145 (50%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEAS G+YVPR VL+DL+P TMD++RSGP+G +FRPDNFV+GQ+ A NNWA
Sbjct: 44  QLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWA 103

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++++ LDV+R+EAE     +   V  +              +   +  P  
Sbjct: 104 KGHYTEGAELIDAVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDR 163

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F  F  P+    VVEPYN TL
Sbjct: 164 MMLTFSVFPSPKVSDTVVEPYNATL 188



 Score = 72.5 bits (170), Expect = 2e-13
 Identities = 29/40 (72%), Positives = 35/40 (87%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDS 249
           MREI+++Q G CGNQIG KFWEVI DEHG+DP+G Y+GDS
Sbjct: 1   MREILHVQGGQCGNQIGSKFWEVICDEHGVDPTGRYNGDS 40



 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = +2

Query: 509 DCLQVFR-CHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+ CH+              +++IREEYPDR++LTFSVFPSP+VSD
Sbjct: 129 DCLQGFQVCHS-LGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSD 178


>At5g23860.1 68418.m02801 tubulin beta-8 chain (TUB8) (TUBB8)
           identical to SP|P29516 Tubulin beta-8 chain {Arabidopsis
           thaliana}; supporting cDNA gi|15451225|gb|AY054693.1|
          Length = 449

 Score =  149 bits (360), Expect = 2e-36
 Identities = 73/145 (50%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLER+NVYYNEAS G++VPR VL+DL+P TMD+VRSGP+G +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERVNVYYNEASCGRFVPRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   V  +              +   +  P  
Sbjct: 103 KGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F  F  P+    VVEPYN TL
Sbjct: 163 MMLTFSVFPSPKVSDTVVEPYNATL 187



 Score = 67.3 bits (157), Expect = 9e-12
 Identities = 27/42 (64%), Positives = 34/42 (80%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEV+  EHGID +G Y G++DL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGENDL 42



 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = +2

Query: 509 DCLQVFR-CHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+ CH+              +++IREEYPDR++LTFSVFPSP+VSD
Sbjct: 128 DCLQGFQVCHS-LGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSD 177


>At5g44340.1 68418.m05429 tubulin beta-4 chain (TUB4) nearly
           identical to SP|P24636 Tubulin beta-4 chain {Arabidopsis
           thaliana}
          Length = 444

 Score =  148 bits (358), Expect = 4e-36
 Identities = 74/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERI+VY+NEAS GKYVPR VL+DL+P TMD++RSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERIDVYFNEASGGKYVPRAVLMDLEPGTMDSLRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   V  +              +   +  P  
Sbjct: 103 KGHYTEGAELIDSVLDVVRKEAENSDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F  F  P+    VVEPYN TL
Sbjct: 163 MMMTFSVFPSPKVSDTVVEPYNATL 187



 Score = 69.3 bits (162), Expect = 2e-12
 Identities = 30/42 (71%), Positives = 34/42 (80%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVI DEHGID +G Y GDS L
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGQYVGDSPL 42



 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 26/51 (50%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = +2

Query: 509 DCLQVFR-CHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+ CH+              +++IREEYPDR+++TFSVFPSP+VSD
Sbjct: 128 DCLQGFQVCHS-LGGGTGSGMGTLLISKIREEYPDRMMMTFSVFPSPKVSD 177


>At5g12250.1 68418.m01439 tubulin beta-6 chain (TUB6) nearly
           identical to SP|P29514 Tubulin beta-6 chain {Arabidopsis
           thaliana}
          Length = 449

 Score =  147 bits (357), Expect = 5e-36
 Identities = 71/145 (48%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLER+NVYYNEAS G+YVPR +L+DL+P TMD+VR+GP+G +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERVNVYYNEASCGRYVPRAILMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++++ LDV+R+EAE     +   V  +              +   +  P  
Sbjct: 103 KGHYTEGAELIDAVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F  F  P+    VVEPYN TL
Sbjct: 163 MMLTFSVFPSPKVSDTVVEPYNATL 187



 Score = 73.3 bits (172), Expect = 1e-13
 Identities = 30/42 (71%), Positives = 36/42 (85%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEV+ DEHGIDP+G Y G+SDL
Sbjct: 1   MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGNSDL 42



 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = +2

Query: 509 DCLQVFR-CHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+ CH+              +++IREEYPDR++LTFSVFPSP+VSD
Sbjct: 128 DCLQGFQVCHS-LGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSD 177


>At5g62700.1 68418.m07868 tubulin beta-2/beta-3 chain (TUB3) nearly
           identical to SP|P29512 Tubulin beta-2/beta-3 chain
           {Arabidopsis thaliana}
          Length = 450

 Score =  146 bits (355), Expect = 9e-36
 Identities = 73/145 (50%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEAS G++VPR VL+DL+P TMD++RSGP+G  FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEASCGRFVPRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   V  +              +   +  P  
Sbjct: 103 KGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F  F  P+    VVEPYN TL
Sbjct: 163 MMLTFSVFPSPKVSDTVVEPYNATL 187



 Score = 72.5 bits (170), Expect = 2e-13
 Identities = 30/42 (71%), Positives = 35/42 (83%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEV+  EHGIDP+G Y GDSDL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDL 42



 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = +2

Query: 509 DCLQVFR-CHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+ CH+              +++IREEYPDR++LTFSVFPSP+VSD
Sbjct: 128 DCLQGFQVCHS-LGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSD 177


>At5g62690.1 68418.m07867 tubulin beta-2/beta-3 chain (TUB2) nearly
           identical to SP|P29512 Tubulin beta-2/beta-3 chain
           {Arabidopsis thaliana}
          Length = 450

 Score =  146 bits (355), Expect = 9e-36
 Identities = 73/145 (50%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEAS G++VPR VL+DL+P TMD++RSGP+G  FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEASCGRFVPRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   V  +              +   +  P  
Sbjct: 103 KGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F  F  P+    VVEPYN TL
Sbjct: 163 MMLTFSVFPSPKVSDTVVEPYNATL 187



 Score = 72.5 bits (170), Expect = 2e-13
 Identities = 30/42 (71%), Positives = 35/42 (83%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEV+  EHGIDP+G Y GDSDL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDL 42



 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = +2

Query: 509 DCLQVFR-CHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+ CH+              +++IREEYPDR++LTFSVFPSP+VSD
Sbjct: 128 DCLQGFQVCHS-LGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSD 177


>At5g19780.1 68418.m02351 tubulin alpha-3/alpha-5 chain (TUA5)
           nearly identical to SP|P20363 Tubulin alpha-3/alpha-5
           chain {Arabidopsis thaliana}
          Length = 450

 Score = 86.6 bits (205), Expect = 1e-17
 Identities = 36/81 (44%), Positives = 56/81 (69%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARG 106

Query: 441 HYTEGVEILESALDVIRREAE 503
           HYT G EI++  LD +R+ A+
Sbjct: 107 HYTVGKEIVDLCLDRVRKLAD 127



 Score = 44.4 bits (100), Expect = 7e-05
 Identities = 18/40 (45%), Positives = 24/40 (60%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDS 249
           MREII++ +G  G Q+G   WE+   EHGI P G    D+
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDT 40


>At5g19770.1 68418.m02350 tubulin alpha-3/alpha-5 chain (TUA3)
           nearly identical to SP|P20363 Tubulin alpha-3/alpha-5
           chain {Arabidopsis thaliana}
          Length = 450

 Score = 86.6 bits (205), Expect = 1e-17
 Identities = 36/81 (44%), Positives = 56/81 (69%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARG 106

Query: 441 HYTEGVEILESALDVIRREAE 503
           HYT G EI++  LD +R+ A+
Sbjct: 107 HYTVGKEIVDLCLDRVRKLAD 127



 Score = 44.4 bits (100), Expect = 7e-05
 Identities = 18/40 (45%), Positives = 24/40 (60%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDS 249
           MREII++ +G  G Q+G   WE+   EHGI P G    D+
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDT 40


>At4g14960.2 68417.m02299 tubulin alpha-6 chain (TUA6) nearly
           identical to SP|P29511 Tubulin alpha-6 chain
           {Arabidopsis thaliana}
          Length = 450

 Score = 86.6 bits (205), Expect = 1e-17
 Identities = 37/81 (45%), Positives = 56/81 (69%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARG 106

Query: 441 HYTEGVEILESALDVIRREAE 503
           HYT G EI++  LD IR+ A+
Sbjct: 107 HYTIGKEIVDLCLDRIRKLAD 127



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 18/39 (46%), Positives = 23/39 (58%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGD 246
           MRE I++ +G  G Q+G   WE+   EHGI P G   GD
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGD 39


>At4g14960.1 68417.m02298 tubulin alpha-6 chain (TUA6) nearly
           identical to SP|P29511 Tubulin alpha-6 chain
           {Arabidopsis thaliana}
          Length = 427

 Score = 86.6 bits (205), Expect = 1e-17
 Identities = 37/81 (45%), Positives = 56/81 (69%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARG 106

Query: 441 HYTEGVEILESALDVIRREAE 503
           HYT G EI++  LD IR+ A+
Sbjct: 107 HYTIGKEIVDLCLDRIRKLAD 127



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 18/39 (46%), Positives = 23/39 (58%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGD 246
           MRE I++ +G  G Q+G   WE+   EHGI P G   GD
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGD 39


>At1g50010.1 68414.m05612 tubulin alpha-2/alpha-4 chain (TUA2)
           identical to tubulin alpha-2/alpha-4 chain SP|P29510
           GB:P29510 from [Arabidopsis thaliana]
          Length = 450

 Score = 86.6 bits (205), Expect = 1e-17
 Identities = 37/81 (45%), Positives = 56/81 (69%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARG 106

Query: 441 HYTEGVEILESALDVIRREAE 503
           HYT G EI++  LD IR+ A+
Sbjct: 107 HYTIGKEIVDLCLDRIRKLAD 127



 Score = 40.7 bits (91), Expect = 9e-04
 Identities = 16/34 (47%), Positives = 21/34 (61%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           MRE I++ +G  G Q+G   WE+   EHGI P G
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDG 34


>At1g04820.1 68414.m00478 tubulin alpha-2/alpha-4 chain (TUA4)
           nearly identical to SP:P29510 Tubulin alpha-2/alpha-4
           chain from [Arabidopsis thaliana]
          Length = 450

 Score = 86.6 bits (205), Expect = 1e-17
 Identities = 37/81 (45%), Positives = 56/81 (69%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARG 106

Query: 441 HYTEGVEILESALDVIRREAE 503
           HYT G EI++  LD IR+ A+
Sbjct: 107 HYTIGKEIVDLCLDRIRKLAD 127



 Score = 40.7 bits (91), Expect = 9e-04
 Identities = 16/34 (47%), Positives = 21/34 (61%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           MRE I++ +G  G Q+G   WE+   EHGI P G
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDG 34


>At1g64740.1 68414.m07340 tubulin alpha-1 chain (TUA1) nearly
           identical to SP|P11139 Tubulin alpha-1 chain
           {Arabidopsis thaliana}
          Length = 450

 Score = 83.8 bits (198), Expect = 1e-16
 Identities = 34/81 (41%), Positives = 58/81 (71%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E S+G++VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DAFNTFFSETSSGQHVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARG 106

Query: 441 HYTEGVEILESALDVIRREAE 503
           HYT G EI+++ L+ +R+ A+
Sbjct: 107 HYTVGREIVDTCLERLRKLAD 127



 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 19/44 (43%), Positives = 26/44 (59%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNS 261
           MREII++ +G  G Q+G   WE+   EHGI P G    DS + +
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDSTVGA 44


>At5g05620.1 68418.m00612 tubulin gamma-2 chain / gamma-2 tubulin
           (TUBG2) identical to  SP|P38558 Tubulin gamma-2 chain
           (Gamma-2 tubulin) {Arabidopsis thaliana}
          Length = 474

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 29/84 (34%), Positives = 51/84 (60%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR +LIDL+P  ++ +++G +  L+  +N     +   A NNWA
Sbjct: 46  DRKDVFFYQADDQHYIPRALLIDLEPRVINGIQNGEYRNLYNHENIFLSDHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G Y +G  + E  +D+I REA+G
Sbjct: 106 SG-YHQGKGVEEEIMDMIDREADG 128



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 21/33 (63%), Positives = 24/33 (72%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           REII LQVG CGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQVGQCGNQIGMEFWKQLCLEHGISKDG 35


>At3g61650.1 68416.m06909 tubulin gamma-1 chain / gamma-1 tubulin
           (TUBG1) identical to SP|P38557 Tubulin gamma-1 chain
           (Gamma-1 tubulin) {Arabidopsis thaliana}
          Length = 474

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 29/84 (34%), Positives = 51/84 (60%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR +LIDL+P  ++ +++G +  L+  +N     +   A NNWA
Sbjct: 46  DRKDVFFYQADDQHYIPRALLIDLEPRVINGIQNGDYRNLYNHENIFVADHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G Y +G  + E  +D+I REA+G
Sbjct: 106 SG-YHQGKGVEEEIMDMIDREADG 128



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 21/33 (63%), Positives = 24/33 (72%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           REII LQVG CGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQVGQCGNQIGMEFWKQLCLEHGISKDG 35


>At4g37190.1 68417.m05265 expressed protein
          Length = 562

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFW 192
           MREI+ +QVG   N +G  FW
Sbjct: 1   MREIVTIQVGEFANFVGSHFW 21


>At1g66050.1 68414.m07497 zinc finger (C3HC4-type RING finger)
           family protein contains zinc finger, C3HC4 type (RING
           finger), signature, PROSITE:PS00518
          Length = 623

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 14/36 (38%), Positives = 20/36 (55%)
 Frame = +2

Query: 182 ESSGR*YLTSTASIQADATTATPTSTRKDQRVLQRG 289
           ESSG   +T+  +IQAD T       +K QR++  G
Sbjct: 77  ESSGSVLVTAIRAIQADVTLTEAEKAKKRQRLMSGG 112


>At1g52430.1 68414.m05919 ubiquitin carboxyl-terminal
           hydrolase-related contains Pfam profiles PF00443:
           Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein
           of unknown function (DUF629), PF04781: Protein of
           unknown function (DUF627)
          Length = 1136

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +3

Query: 417 AANNWAKGHYTEGVEILESALDVIRREAEGWI 512
           A ++ AKG+Y E ++ILE  + + R +   W+
Sbjct: 16  ANDHIAKGNYIEALKILEDLIRIHREDQNAWL 47


>At5g62120.1 68418.m07797 hypothetical protein
          Length = 145

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 12/30 (40%), Positives = 16/30 (53%)
 Frame = -2

Query: 222 IDAVLVRYHLPELSADLVSTRTDLEIDNFP 133
           ID V+  YH+P L+   +  R D E  N P
Sbjct: 19  IDVVITDYHMPGLNGVQLKKRIDEEFGNLP 48


>At3g49900.1 68416.m05455 BTB/POZ domain-containing protein contains
           BTB/POZ domain, INTERPRO:IPR000210
          Length = 517

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 15/63 (23%), Positives = 28/63 (44%)
 Frame = +3

Query: 207 RARHRSKRMLPRRLRPQLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFR 386
           RA   S       L  +L+ +  + ++ S  +   R ++     + MD+ RS  F C+ +
Sbjct: 360 RAAMNSTSSRIESLEKELDTMKRFLSKESEKQKSDRNIVESRSRSVMDSARSASFHCVHQ 419

Query: 387 PDN 395
           P N
Sbjct: 420 PSN 422


>At3g31910.1 68416.m04037 hypothetical protein
          Length = 399

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 4/41 (9%)
 Frame = -3

Query: 689 QRCV----IWLHHTNPTLGDLERLKRSV*FCRDTLRVSCSR 579
           QRCV    IW++ + P LG++  +KR +  C   L  + SR
Sbjct: 173 QRCVHALVIWIYESVPGLGEIYGMKRDILTCIPLLDWNSSR 213


>At5g64790.1 68418.m08146 glycosyl hydrolase family 17 protein
           similar to elicitor inducible chitinase Nt-SubE76
           GI:11071974 from [Nicotiana tabacum]
          Length = 485

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 13/26 (50%), Positives = 14/26 (53%), Gaps = 1/26 (3%)
 Frame = +1

Query: 205 DEHGIDPS-GCYHGDSDLNSKGSTCT 279
           DE G D    CYHGD      GSTC+
Sbjct: 380 DEVGPDLDYACYHGDCTAMEAGSTCS 405


>At5g37175.1 68418.m04463 hypothetical protein
          Length = 136

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = +2

Query: 236 TTATPTSTRKDQRVLQRGIGWEICSSHGSYRLE 334
           TT+T +  RK++     G GW +   HG+  LE
Sbjct: 6   TTSTMSGRRKEEENGNPGFGWVLKDPHGTTLLE 38


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,827,039
Number of Sequences: 28952
Number of extensions: 305926
Number of successful extensions: 937
Number of sequences better than 10.0: 26
Number of HSP's better than 10.0 without gapping: 858
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 935
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1477286152
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -