SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30122.Seq
         (669 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g13580.3 68416.m01710 60S ribosomal protein L7 (RPL7D) simila...    94   9e-20
At3g13580.2 68416.m01709 60S ribosomal protein L7 (RPL7D) simila...    94   9e-20
At3g13580.1 68416.m01708 60S ribosomal protein L7 (RPL7D) simila...    94   9e-20
At2g44120.2 68415.m05488 60S ribosomal protein L7 (RPL7C)              92   3e-19
At2g44120.1 68415.m05487 60S ribosomal protein L7 (RPL7C)              92   3e-19
At2g01250.1 68415.m00037 60S ribosomal protein L7 (RPL7B)              89   3e-18
At1g80750.1 68414.m09474 60S ribosomal protein L7 (RPL7A) simila...    49   2e-06
At3g52860.1 68416.m05825 expressed protein                             31   0.92 
At5g45310.1 68418.m05562 expressed protein                             28   4.9  
At1g58220.1 68414.m06612 myb family transcription factor contain...    28   4.9  
At3g19620.1 68416.m02487 glycosyl hydrolase family 3 protein sim...    28   6.5  
At5g06740.1 68418.m00762 lectin protein kinase family protein co...    27   8.5  
At3g59970.3 68416.m06695 methylenetetrahydrofolate reductase 1 (...    27   8.5  
At1g26540.1 68414.m03234 agenet domain-containing protein contai...    27   8.5  

>At3g13580.3 68416.m01710 60S ribosomal protein L7 (RPL7D) similar
           to 60S ribosomal protein L7 GB:AAD14525 GI:4262232 from
           [Arabidopsis thaliana]
          Length = 244

 Score = 93.9 bits (223), Expect = 9e-20
 Identities = 45/88 (51%), Positives = 60/88 (68%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           + +K+LQL RLRQI NGVF+++NKAT+NMLR  EPY+ +GYPNLKSV+EL+         
Sbjct: 100 KTKKILQLLRLRQIFNGVFLKVNKATINMLRRVEPYVTYGYPNLKSVKELIYKRGFGKLN 159

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    +++ +G  KH IICVEDLI
Sbjct: 160 HQRTALTDNSIVDQGLGKHGIICVEDLI 187



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G +YV  EAKL F+IRIRGIN + PK+ K    L
Sbjct: 75  GGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLL 108



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 22/63 (34%), Positives = 32/63 (50%)
 Frame = +3

Query: 66  DSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKER 245
           +++    VPESVLK             Q     +    +K++ IF RA+QY KEY+ KER
Sbjct: 3   EAESKTVVPESVLKKRKREEEWALAKKQELEAAKKQNAEKRKLIFNRAKQYSKEYQEKER 62

Query: 246 DEI 254
           + I
Sbjct: 63  ELI 65


>At3g13580.2 68416.m01709 60S ribosomal protein L7 (RPL7D) similar
           to 60S ribosomal protein L7 GB:AAD14525 GI:4262232 from
           [Arabidopsis thaliana]
          Length = 244

 Score = 93.9 bits (223), Expect = 9e-20
 Identities = 45/88 (51%), Positives = 60/88 (68%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           + +K+LQL RLRQI NGVF+++NKAT+NMLR  EPY+ +GYPNLKSV+EL+         
Sbjct: 100 KTKKILQLLRLRQIFNGVFLKVNKATINMLRRVEPYVTYGYPNLKSVKELIYKRGFGKLN 159

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    +++ +G  KH IICVEDLI
Sbjct: 160 HQRTALTDNSIVDQGLGKHGIICVEDLI 187



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G +YV  EAKL F+IRIRGIN + PK+ K    L
Sbjct: 75  GGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLL 108



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 22/63 (34%), Positives = 32/63 (50%)
 Frame = +3

Query: 66  DSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKER 245
           +++    VPESVLK             Q     +    +K++ IF RA+QY KEY+ KER
Sbjct: 3   EAESKTVVPESVLKKRKREEEWALAKKQELEAAKKQNAEKRKLIFNRAKQYSKEYQEKER 62

Query: 246 DEI 254
           + I
Sbjct: 63  ELI 65


>At3g13580.1 68416.m01708 60S ribosomal protein L7 (RPL7D) similar
           to 60S ribosomal protein L7 GB:AAD14525 GI:4262232 from
           [Arabidopsis thaliana]
          Length = 244

 Score = 93.9 bits (223), Expect = 9e-20
 Identities = 45/88 (51%), Positives = 60/88 (68%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           + +K+LQL RLRQI NGVF+++NKAT+NMLR  EPY+ +GYPNLKSV+EL+         
Sbjct: 100 KTKKILQLLRLRQIFNGVFLKVNKATINMLRRVEPYVTYGYPNLKSVKELIYKRGFGKLN 159

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    +++ +G  KH IICVEDLI
Sbjct: 160 HQRTALTDNSIVDQGLGKHGIICVEDLI 187



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G +YV  EAKL F+IRIRGIN + PK+ K    L
Sbjct: 75  GGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLL 108



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 22/63 (34%), Positives = 32/63 (50%)
 Frame = +3

Query: 66  DSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKER 245
           +++    VPESVLK             Q     +    +K++ IF RA+QY KEY+ KER
Sbjct: 3   EAESKTVVPESVLKKRKREEEWALAKKQELEAAKKQNAEKRKLIFNRAKQYSKEYQEKER 62

Query: 246 DEI 254
           + I
Sbjct: 63  ELI 65


>At2g44120.2 68415.m05488 60S ribosomal protein L7 (RPL7C) 
          Length = 247

 Score = 92.3 bits (219), Expect = 3e-19
 Identities = 45/88 (51%), Positives = 59/88 (67%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           + +K+LQL RLRQI NGVF+++NKATVNMLR  EPY+ +GYPNLKSV+EL+         
Sbjct: 103 KTKKILQLLRLRQIFNGVFLKVNKATVNMLRRVEPYVTYGYPNLKSVKELIYKRGYGKLN 162

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    +++ +   KH IICVEDLI
Sbjct: 163 HQRIALTDNSIVDQALGKHGIICVEDLI 190



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G +YV  EAKL F+IRIRGIN + PK+ K    L
Sbjct: 78  GGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLL 111



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 20/56 (35%), Positives = 29/56 (51%)
 Frame = +3

Query: 87  VPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEI 254
           VPESVLK                +  +  +++ ++ IFKRAEQY KEY  K+ + I
Sbjct: 13  VPESVLKKIKRQEEWALAKKDEAVAAKKKSVEARKLIFKRAEQYAKEYAEKDNELI 68


>At2g44120.1 68415.m05487 60S ribosomal protein L7 (RPL7C) 
          Length = 242

 Score = 92.3 bits (219), Expect = 3e-19
 Identities = 45/88 (51%), Positives = 59/88 (67%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           + +K+LQL RLRQI NGVF+++NKATVNMLR  EPY+ +GYPNLKSV+EL+         
Sbjct: 98  KTKKILQLLRLRQIFNGVFLKVNKATVNMLRRVEPYVTYGYPNLKSVKELIYKRGYGKLN 157

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    +++ +   KH IICVEDLI
Sbjct: 158 HQRIALTDNSIVDQALGKHGIICVEDLI 185



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G +YV  EAKL F+IRIRGIN + PK+ K    L
Sbjct: 73  GGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLL 106



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 20/56 (35%), Positives = 29/56 (51%)
 Frame = +3

Query: 87  VPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEI 254
           VPESVLK                +  +  +++ ++ IFKRAEQY KEY  K+ + I
Sbjct: 8   VPESVLKKIKRQEEWALAKKDEAVAAKKKSVEARKLIFKRAEQYAKEYAEKDNELI 63


>At2g01250.1 68415.m00037 60S ribosomal protein L7 (RPL7B)
          Length = 242

 Score = 88.6 bits (210), Expect = 3e-18
 Identities = 42/88 (47%), Positives = 58/88 (65%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           + +K+LQL RLRQI NGVF+++NKAT+NMLR  EPY+ +G+PNLKSV+EL+         
Sbjct: 98  KTKKILQLLRLRQIFNGVFLKVNKATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKLN 157

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    +++ +   KH IIC EDLI
Sbjct: 158 HQRIALTDNSIVEQALGKHGIICTEDLI 185



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G +YV  EAKL F+IRIRGIN + PK+ K    L
Sbjct: 73  GGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLL 106



 Score = 37.9 bits (84), Expect = 0.006
 Identities = 22/56 (39%), Positives = 28/56 (50%)
 Frame = +3

Query: 87  VPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEI 254
           VPESVLK             Q     +    + ++ IFKRAEQY KEY  KE++ I
Sbjct: 8   VPESVLKKRKREEEWALEKKQNVEAAKKKNAENRKLIFKRAEQYSKEYAEKEKELI 63


>At1g80750.1 68414.m09474 60S ribosomal protein L7 (RPL7A) similar
           to ribosomal protein L7 GB:AAA03081 GI:307388 from [Homo
           sapiens]
          Length = 247

 Score = 49.2 bits (112), Expect = 2e-06
 Identities = 22/88 (25%), Positives = 44/88 (50%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           + +++L   +L+ +  GVF +   +    L   +PY+ +GYPN KSV++L+         
Sbjct: 102 KTKRILNNLQLKSVFTGVFAKATDSLFQKLLKVQPYVTYGYPNDKSVKDLIYKKGCTIIE 161

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
            N        ++ +   +H I+ +EDL+
Sbjct: 162 GNPVPLTDNNIIEQALGEHKILGIEDLV 189



 Score = 33.5 bits (73), Expect = 0.13
 Identities = 44/186 (23%), Positives = 71/186 (38%), Gaps = 12/186 (6%)
 Frame = +3

Query: 60  KEDSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIK 239
           +E++K L  +PE VLK             +      S   KKK    KR E +V E+R K
Sbjct: 3   EEEAKGLDYIPEIVLKKRKNRDELAFIRKKQLELGNSGKKKKKVSDIKRPEDFVHEFRAK 62

Query: 240 ERDEI------------D*PDKHAIVATTTFPGKPNWHLSSESVVSTKFHRSP*SSATV* 383
           E D I              P K  +V      GK + H  ++ +++    +S  +     
Sbjct: 63  EVDMIRMKQRVKRPKSSPPPVKSDLVFIIRIQGKNDMHPKTKRILNNLQLKSVFTGVFAK 122

Query: 384 TAPNKQWCVCTSE*GYCEYATYRRALHCLGIPQLKECP*VSIKRGFAKLSGQRIPITSNS 563
              +    +   +     Y TY       G P  K    +  K+G   + G  +P+T N+
Sbjct: 123 ATDSLFQKLLKVQ----PYVTY-------GYPNDKSVKDLIYKKGCTIIEGNPVPLTDNN 171

Query: 564 IVEKRL 581
           I+E+ L
Sbjct: 172 IIEQAL 177



 Score = 28.3 bits (60), Expect = 4.9
 Identities = 12/29 (41%), Positives = 19/29 (65%)
 Frame = +2

Query: 296 PGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           P ++ L F+IRI+G N + PK+ +  N L
Sbjct: 82  PVKSDLVFIIRIQGKNDMHPKTKRILNNL 110


>At3g52860.1 68416.m05825 expressed protein 
          Length = 156

 Score = 30.7 bits (66), Expect = 0.92
 Identities = 13/38 (34%), Positives = 23/38 (60%)
 Frame = +3

Query: 144 LQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEID 257
           ++  LK +   IKK   +F+ +++ VKE   K RDE++
Sbjct: 117 MEEELKTKDELIKKHMRLFQESQKLVKEQIEKHRDELE 154


>At5g45310.1 68418.m05562 expressed protein
          Length = 352

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 12/29 (41%), Positives = 19/29 (65%)
 Frame = +3

Query: 186 KREIFKRAEQYVKEYRIKERDEID*PDKH 272
           ++EI K   + +KEYRI E+D  +  D+H
Sbjct: 107 RKEIEKNLREAIKEYRIMEQDLDELEDEH 135


>At1g58220.1 68414.m06612 myb family transcription factor contains
           Pfam profile: PF00249: Myb-like DNA-binding domain
          Length = 834

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 12/42 (28%), Positives = 20/42 (47%)
 Frame = -1

Query: 666 KLLAYLNFSPTVKISWNEVLNTDNVVFMEASSQQCCWK*LVY 541
           KLL  + +    K++WNE++   +     A   Q  W+ L Y
Sbjct: 33  KLLQEMAYYAEAKMNWNELVKKTSTGITSAREYQLLWRHLAY 74


>At3g19620.1 68416.m02487 glycosyl hydrolase family 3 protein
           similar to beta-xylosidase A GB:BAA28267 from
           [Aspergillus oryzae]
          Length = 781

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 8/18 (44%), Positives = 14/18 (77%)
 Frame = -2

Query: 629 RSHGMRSSTQIMLCLWKP 576
           ++HG+RS + ++L  WKP
Sbjct: 677 KNHGLRSGSHVVLVFWKP 694


>At5g06740.1 68418.m00762 lectin protein kinase family protein
           contains Legume lectins beta-chain signature,
           PROSITE:PS00307 and Serine/Threonine protein kinases
           active-site signature, PROSITE:PS00108
          Length = 652

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = +1

Query: 310 IGICHPNPWYQPSFTEVRKVL 372
           +  CHPNP  +PS   V KVL
Sbjct: 586 LACCHPNPNQRPSMKTVLKVL 606


>At3g59970.3 68416.m06695 methylenetetrahydrofolate reductase 1
           (MTHFR1) identical to methylenetetrahydrofolate
           reductase MTHFR1 [Arabidopsis thaliana] GI:5911425
          Length = 592

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%)
 Frame = +1

Query: 310 IGICHPNPWYQPSFTEVRKVLQLFRLRQINNGVFVRLN-KATVNMLRIAEPYIAWGYP 480
           IG    +PW +    +    +   +L +IN+  F+ +N + +VN  +   P I WG P
Sbjct: 403 IGNLKSSPWSELDGLQPETKIINEQLGKINSNGFLTINSQPSVNAAKSDSPAIGWGGP 460


>At1g26540.1 68414.m03234 agenet domain-containing protein contains
           Pfam PF05641: Agenet domain
          Length = 695

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%)
 Frame = -1

Query: 387 QSKQLQNFTDF-GETWLIPRIRMTNANLASPGT 292
           + KQL+    + G TW+ P I  +N ++ SPGT
Sbjct: 126 ERKQLRTHLIWTGGTWIQPEIEESNKSMFSPGT 158


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,367,449
Number of Sequences: 28952
Number of extensions: 269852
Number of successful extensions: 683
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 638
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 670
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1412971776
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -