SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30120.Seq
         (576 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g80460.1 68414.m09423 glycerol kinase, putative similar to gl...    48   3e-06
At4g30310.3 68417.m04309 ribitol kinase, putative similar to rib...    35   0.045
At4g30310.2 68417.m04308 ribitol kinase, putative similar to rib...    35   0.045
At4g24900.1 68417.m03564 expressed protein                             30   1.3  
At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c...    29   2.9  
At5g27420.1 68418.m03273 zinc finger (C3HC4-type RING finger) fa...    28   3.9  
At3g02830.1 68416.m00275 zinc finger (CCCH-type) family protein ...    28   3.9  
At1g10520.1 68414.m01184 DNA polymerase lambda (POLL) identical ...    28   3.9  
At5g24480.1 68418.m02885 hypothetical protein similar to unknown...    28   5.1  
At3g14130.1 68416.m01787 (S)-2-hydroxy-acid oxidase, peroxisomal...    28   5.1  
At4g39030.1 68417.m05528 enhanced disease susceptibility 5 (EDS5...    27   6.8  

>At1g80460.1 68414.m09423 glycerol kinase, putative similar to
           glycerol kinase (ATP:glycerol 3-phosphotransferase,
           Glycerokinase, GK)[Mycobacterium tuberculosis]
           Swiss-Prot:O69664
          Length = 522

 Score = 48.4 bits (110), Expect = 3e-06
 Identities = 21/36 (58%), Positives = 29/36 (80%)
 Frame = -2

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +Q+QADL+G PV+RP+ +E+TALGAA  AG A+  W
Sbjct: 438 MQIQADLMGSPVVRPVDIETTALGAAYAAGLAVGFW 473


>At4g30310.3 68417.m04309 ribitol kinase, putative similar to
           ribitol kinase [Klebsiella pneumoniae]
           gi|2905643|gb|AAC26495
          Length = 451

 Score = 34.7 bits (76), Expect = 0.045
 Identities = 16/38 (42%), Positives = 24/38 (63%)
 Frame = -2

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPT 396
           +Q  AD++G P+I P   ES  LGAAI+   A + +P+
Sbjct: 361 IQEHADIVGCPIILPRESESVLLGAAILGAVAGKNYPS 398


>At4g30310.2 68417.m04308 ribitol kinase, putative similar to
           ribitol kinase [Klebsiella pneumoniae]
           gi|2905643|gb|AAC26495
          Length = 579

 Score = 34.7 bits (76), Expect = 0.045
 Identities = 16/38 (42%), Positives = 24/38 (63%)
 Frame = -2

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPT 396
           +Q  AD++G P+I P   ES  LGAAI+   A + +P+
Sbjct: 489 IQEHADIVGCPIILPRESESVLLGAAILGAVAGKNYPS 526


>At4g24900.1 68417.m03564 expressed protein
          Length = 421

 Score = 29.9 bits (64), Expect = 1.3
 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 1/52 (1%)
 Frame = -1

Query: 510 CADAG*FTGYTSHSSPHDGK-YSPGGGHCRRSRNACVAHDNTQPTGRYIPAG 358
           C ++G   G+  HS P   K YS  G +C +  N  V+ D  Q  G Y P G
Sbjct: 224 CDESG--NGFGEHSIPCRSKDYSGNGNYCTQE-NYQVSQDKKQIDGSYNPPG 272


>At1g27750.1 68414.m03391 ubiquitin system component Cue
            domain-containing protein very low similarity to ASC-1
            complex subunit P100 [Homo sapiens] GI:12061187; contains
            Pfam profile PF02845: CUE domain
          Length = 1973

 Score = 28.7 bits (61), Expect = 2.9
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 5/69 (7%)
 Frame = -3

Query: 388  PAHRPIHSCRLLPMKNEKCGEFVGKKP*INAWDGPILK--MNMST---QKIR*NYCSFAA 224
            P   P+ S RL PM  + CG    K+   + W G + K  ++ ST   Q++  + C +  
Sbjct: 899  PPFSPLLSPRLPPMVTQLCGSEASKQNIGHQWQGALSKSGVHYSTIIAQRLESDICKYII 958

Query: 223  GTFFPRNRP 197
            G+  P   P
Sbjct: 959  GSPEPVQWP 967


>At5g27420.1 68418.m03273 zinc finger (C3HC4-type RING finger)
           family protein similar to RING-H2 zinc finger protein
           ATL6 [Arabidopsis thaliana]
           gi|4928403|gb|AAD33584.1|AF132016_1[4928403]; contains
           Pfam domain, PF00097: Zinc finger, C3HC4 type (RING
           finger)
          Length = 368

 Score = 28.3 bits (60), Expect = 3.9
 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 1/50 (2%)
 Frame = -1

Query: 498 G*FTGYTSH-SSPHDGKYSPGGGHCRRSRNACVAHDNTQPTGRYIPAGSY 352
           G FT Y  H +   DG  +P GG  RR  NA VA      T    P   Y
Sbjct: 60  GFFTVYIRHCTGAVDGSVTPAGGARRRVTNATVARGLDAETIETFPTFVY 109


>At3g02830.1 68416.m00275 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 397

 Score = 28.3 bits (60), Expect = 3.9
 Identities = 14/46 (30%), Positives = 17/46 (36%)
 Frame = -1

Query: 486 GYTSHSSPHDGKYSPGGGHCRRSRNACVAHDNTQPTGRYIPAGSYQ 349
           GY   S+  D  Y    GHC+        H   QPT   +P    Q
Sbjct: 127 GYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQ 172


>At1g10520.1 68414.m01184 DNA polymerase lambda (POLL) identical to
           DNA polymerase lambda GI:12053869 from [Arabidopsis
           thaliana]
          Length = 529

 Score = 28.3 bits (60), Expect = 3.9
 Identities = 13/37 (35%), Positives = 19/37 (51%)
 Frame = -1

Query: 552 GNSSPTEGWRRTQFCADAG*FTGYTSHSSPHDGKYSP 442
           G+   +   +RT++  DAG F G  SHS+      SP
Sbjct: 128 GSEDQSSPQKRTRYSPDAGDFKGVESHSNTQGSPDSP 164


>At5g24480.1 68418.m02885 hypothetical protein similar to unknown
           protein (gb|AAD32930.1)
          Length = 350

 Score = 27.9 bits (59), Expect = 5.1
 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 3/39 (7%)
 Frame = -2

Query: 470 RPLMMESTALGAAIVAGRAMRVWPTTIPSP---PADTFL 363
           RP          ++ + R  R WP T+PSP    A TFL
Sbjct: 10  RPHFQSIHFFDCSLTSDRGQRSWPATLPSPQPLSASTFL 48


>At3g14130.1 68416.m01787 (S)-2-hydroxy-acid oxidase, peroxisomal,
           putative / glycolate oxidase, putative / short chain
           alpha-hydroxy acid oxidase, putative similar to Chain A,
           Glycolate Oxidase (E.C.1.1.3.15) Mutant With Tyr 24
           Replaced By Phe (Y24f) gi|999542
          Length = 363

 Score = 27.9 bits (59), Expect = 5.1
 Identities = 11/33 (33%), Positives = 20/33 (60%)
 Frame = -2

Query: 539 RRRDGAELSSVQMQADLLGIPVIRPLMMESTAL 441
           R R   ++S++ M   +LG P+  P+M+  TA+
Sbjct: 49  RPRVLVDVSNIDMSTSMLGYPISAPIMIAPTAM 81


>At4g39030.1 68417.m05528 enhanced disease susceptibility 5 (EDS5) /
           salicylic acid induction deficient 1 (SID1) identical to
           SP|Q945F0; contains Pfam profile PF01554:
           Uncharacterized membrane protein family
          Length = 543

 Score = 27.5 bits (58), Expect = 6.8
 Identities = 13/30 (43%), Positives = 15/30 (50%)
 Frame = -3

Query: 442 WGRPLSQVAQCVCGPRQYPAHRPIHSCRLL 353
           WG PLSQ AQ       Y A+R +   R L
Sbjct: 371 WGEPLSQTAQSFMPEMLYGANRNLPKARTL 400


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,066,607
Number of Sequences: 28952
Number of extensions: 264614
Number of successful extensions: 581
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 560
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 581
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1121903184
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -