SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30119.Seq
         (448 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g26230.1 68417.m03776 60S ribosomal protein L31 (RPL31B) ribo...   103   5e-23
At5g56710.1 68418.m07078 60S ribosomal protein L31 (RPL31C)           101   3e-22
At2g19740.1 68415.m02306 60S ribosomal protein L31 (RPL31A)           100   5e-22
At4g17250.1 68417.m02594 expressed protein                             28   2.5  
At3g23530.1 68416.m02961 cyclopropane fatty acid synthase, putat...    28   2.5  
At3g19400.2 68416.m02460 cysteine proteinase, putative non-conse...    28   2.5  
At3g19400.1 68416.m02461 cysteine proteinase, putative non-conse...    28   2.5  
At3g51220.1 68416.m05607 expressed protein contains Pfam doamin ...    27   4.4  
At1g32900.1 68414.m04053 starch synthase, putative similar to st...    27   5.8  
At3g23510.1 68416.m02960 cyclopropane fatty acid synthase, putat...    27   7.6  

>At4g26230.1 68417.m03776 60S ribosomal protein L31 (RPL31B)
           ribosomal protein L31, Nicotiana glutinosa, U23784
          Length = 119

 Score =  103 bits (247), Expect = 5e-23
 Identities = 46/67 (68%), Positives = 57/67 (85%)
 Frame = +3

Query: 60  ERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLN 239
           E+KG+    EVVTREYT+NLH+RLH   FKK+AP+AIKEIRKFAEK+MGT D+RVD +LN
Sbjct: 3   EKKGRK--EEVVTREYTINLHRRLHSCTFKKKAPKAIKEIRKFAEKEMGTKDVRVDVKLN 60

Query: 240 KFLWSRG 260
           K +WS+G
Sbjct: 61  KQIWSKG 67



 Score = 29.5 bits (63), Expect = 1.1
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 2/33 (6%)
 Frame = +2

Query: 308 NDDEDSAHKLFTLVTY--VPVASIKGLQTENVD 400
           NDDED+  + F+LVT   +P   + GL T+ ++
Sbjct: 84  NDDEDAKEEFFSLVTVAEIPAEGLSGLGTKIIE 116


>At5g56710.1 68418.m07078 60S ribosomal protein L31 (RPL31C)
          Length = 119

 Score =  101 bits (241), Expect = 3e-22
 Identities = 45/67 (67%), Positives = 56/67 (83%)
 Frame = +3

Query: 60  ERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLN 239
           E+KG+    EV+TREYT+NLH+RLH   FKK+AP+AIKEIRKFAEK MGT D+RVD +LN
Sbjct: 3   EKKGRK--EEVITREYTINLHRRLHKCTFKKKAPKAIKEIRKFAEKAMGTKDVRVDVKLN 60

Query: 240 KFLWSRG 260
           K +WS+G
Sbjct: 61  KQIWSKG 67



 Score = 29.5 bits (63), Expect = 1.1
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 2/33 (6%)
 Frame = +2

Query: 308 NDDEDSAHKLFTLVTY--VPVASIKGLQTENVD 400
           NDDED+  + F+LVT   +P   + GL T+ ++
Sbjct: 84  NDDEDAKEEFFSLVTVAEIPAEGLSGLGTKVIE 116


>At2g19740.1 68415.m02306 60S ribosomal protein L31 (RPL31A)
          Length = 119

 Score =  100 bits (239), Expect = 5e-22
 Identities = 45/65 (69%), Positives = 52/65 (80%)
 Frame = +3

Query: 66  KGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKF 245
           KGK    EVVTREYT+NLH+RLH   FKK+AP AIKEIRKFA K MGT D+RVD +LNK 
Sbjct: 3   KGKGRKEEVVTREYTINLHRRLHSCTFKKKAPNAIKEIRKFALKAMGTKDVRVDVKLNKQ 62

Query: 246 LWSRG 260
           +WS+G
Sbjct: 63  IWSKG 67



 Score = 29.5 bits (63), Expect = 1.1
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 2/33 (6%)
 Frame = +2

Query: 308 NDDEDSAHKLFTLVTY--VPVASIKGLQTENVD 400
           NDDED+  + F+LVT   +P   + GL T+ ++
Sbjct: 84  NDDEDAKEEFFSLVTVAEIPAEGLSGLGTKVIE 116


>At4g17250.1 68417.m02594 expressed protein
          Length = 416

 Score = 28.3 bits (60), Expect = 2.5
 Identities = 13/40 (32%), Positives = 22/40 (55%)
 Frame = +3

Query: 108 TVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVD 227
           TV   KR   + +KKR   A+K+   + E++ G P ++ D
Sbjct: 169 TVPATKRFLELKYKKRYEFALKQCPSYTERRRGVPKLKED 208


>At3g23530.1 68416.m02961 cyclopropane fatty acid synthase, putative
           / CPA-FA synthase, putative similar to cyclopropane
           synthase [Sterculia foetida] GI:21069167; contains Pfam
           profiles PF02353: Cyclopropane-fatty-acyl-phospholipid
           synthase, PF01593: amine oxidase, flavin-containing
          Length = 867

 Score = 28.3 bits (60), Expect = 2.5
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = +3

Query: 171 KEIRKFAEKQMGTPDIRVDTRLNKFLWSRG-SEMF 272
           +++ K+ E+  G PDI     L +FL SRG SE+F
Sbjct: 128 EDVLKYIEELEGNPDIDRKETLGEFLNSRGYSELF 162


>At3g19400.2 68416.m02460 cysteine proteinase, putative
           non-consensus AT acceptor site at exon 3; contains
           similarity to cysteine protease CYP1 GI:2828252, TDI-65
           GI:5726641 from [Lycopersicon esculentum]
          Length = 290

 Score = 28.3 bits (60), Expect = 2.5
 Identities = 13/48 (27%), Positives = 24/48 (50%)
 Frame = +3

Query: 102 EYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKF 245
           ++ V   K  +G+G K+R  +  K+  KF ++    PD   +  L +F
Sbjct: 46  QWLVENRKNYNGLGEKERRFKIFKDNLKFVDEHNSVPDRTFEVGLTRF 93


>At3g19400.1 68416.m02461 cysteine proteinase, putative
           non-consensus AT acceptor site at exon 3; contains
           similarity to cysteine protease CYP1 GI:2828252, TDI-65
           GI:5726641 from [Lycopersicon esculentum]
          Length = 362

 Score = 28.3 bits (60), Expect = 2.5
 Identities = 13/48 (27%), Positives = 24/48 (50%)
 Frame = +3

Query: 102 EYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKF 245
           ++ V   K  +G+G K+R  +  K+  KF ++    PD   +  L +F
Sbjct: 46  QWLVENRKNYNGLGEKERRFKIFKDNLKFVDEHNSVPDRTFEVGLTRF 93


>At3g51220.1 68416.m05607 expressed protein contains Pfam doamin
           PF05701: Plant protein of unknown function (DUF827)
          Length = 186

 Score = 27.5 bits (58), Expect = 4.4
 Identities = 16/71 (22%), Positives = 31/71 (43%)
 Frame = +3

Query: 33  KITMAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTP 212
           K  + K + E K  S + E +T+E      K  H +      P+   +++   E  +  P
Sbjct: 53  KENLKKAEEENKVLSQLIESLTQELETTKEKLNHSLRNFPEHPQVEDDLKFIEESTVNEP 112

Query: 213 DIRVDTRLNKF 245
           D   + ++N+F
Sbjct: 113 DNITEIKMNRF 123


>At1g32900.1 68414.m04053 starch synthase, putative similar to
           starch synthase SP:Q42857 from [Ipomoea batatas]
          Length = 610

 Score = 27.1 bits (57), Expect = 5.8
 Identities = 14/55 (25%), Positives = 26/55 (47%)
 Frame = +3

Query: 60  ERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRV 224
           E+KG   + E +++   +N+   + G G KK   + ++   KF  K +G     V
Sbjct: 412 EQKGSDILVEAISKFMGLNVQMVILGTGKKKMEAQILELEEKFPGKAVGVAKFNV 466


>At3g23510.1 68416.m02960 cyclopropane fatty acid synthase, putative
           / CPA-FA synthase, putative similar to cyclopropane
           synthase [Sterculia foetida] GI:21069167; contains Pfam
           profile PF02353: Cyclopropane-fatty-acyl-phospholipid
           synthase
          Length = 867

 Score = 26.6 bits (56), Expect = 7.6
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%)
 Frame = +3

Query: 171 KEIRKFAEKQMGTPDIRVDTRLNKFLWSRG-SEMF 272
           +++  + EK  G PDI     L +FL +RG SE+F
Sbjct: 128 EDVLNYIEKLEGNPDIDRKETLGEFLNTRGYSELF 162


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,978,497
Number of Sequences: 28952
Number of extensions: 167040
Number of successful extensions: 341
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 336
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 341
length of database: 12,070,560
effective HSP length: 75
effective length of database: 9,899,160
effective search space used: 722638680
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -