SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30117.Seq
         (608 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g36020.1 68417.m05128 cold-shock DNA-binding family protein c...    39   0.003
At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c...    36   0.016
At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /...    36   0.016
At3g45830.1 68416.m04960 expressed protein                             29   1.8  
At4g18740.2 68417.m02770 expressed protein                             29   3.2  
At4g18740.1 68417.m02769 expressed protein                             29   3.2  
At2g33620.3 68415.m04122 DNA-binding family protein / AT-hook pr...    29   3.2  
At2g33620.2 68415.m04121 DNA-binding family protein / AT-hook pr...    29   3.2  
At2g33620.1 68415.m04120 DNA-binding family protein / AT-hook pr...    29   3.2  
At1g25540.1 68414.m03171 phytochrome and flowering time regulato...    28   5.6  
At5g50800.1 68418.m06293 nodulin MtN3 family protein similar to ...    27   7.4  
At5g45190.1 68418.m05547 cyclin family protein similar to cyclin...    27   7.4  
At4g19600.1 68417.m02880 cyclin family protein similar to cyclin...    27   7.4  
At2g39650.1 68415.m04862 expressed protein contains Pfam profile...    27   7.4  
At2g17870.1 68415.m02070 cold-shock DNA-binding family protein c...    27   9.7  

>At4g36020.1 68417.m05128 cold-shock DNA-binding family protein
           contains Pfam domains, PF00313: 'Cold-shock' DNA-binding
           domain and PF00098: Zinc knuckle
          Length = 299

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG-FEAAGVTGPGGEPVK 413
           ++FVHQ++I      +  RS+  G+AVEFA+  G  G  +A  VT PGG  +K
Sbjct: 35  ELFVHQSSIVS----EGYRSLTVGDAVEFAITQGSDGKTKAVNVTAPGGGSLK 83



 Score = 32.3 bits (70), Expect = 0.26
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +1

Query: 178 AEKVSGTVKWFNVKSGYGFINRND 249
           A + +G V WFN   GYGFI  +D
Sbjct: 8   AARSTGKVNWFNASKGYGFITPDD 31


>At4g38680.1 68417.m05477 cold-shock DNA-binding family protein
           contains Pfam domains PF00313: 'Cold-shock' DNA-binding
           domain and PF00098: Zinc knuckle
          Length = 203

 Score = 36.3 bits (80), Expect = 0.016
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAV-VAGEKGFEAAGVTGPGGEPVKGS 419
           +D+FVHQ++I      +  RS+   EAVEF V +      +A  V+GP G PV+G+
Sbjct: 34  DDLFVHQSSIRS----EGFRSLAAEEAVEFEVEIDNNNRPKAIDVSGPDGAPVQGN 85



 Score = 31.9 bits (69), Expect = 0.34
 Identities = 11/23 (47%), Positives = 17/23 (73%)
 Frame = +1

Query: 181 EKVSGTVKWFNVKSGYGFINRND 249
           E+  G+VKWF+ + G+GFI  +D
Sbjct: 9   ERRKGSVKWFDTQKGFGFITPDD 31


>At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /
           glycine-rich protein (GRP2) identical to Glycine-rich
           protein 2b (AtGRP2b) [Arabidopsis thaliana]
           SWISS-PROT:Q38896; contains Pfam domains PF00313:
           'Cold-shock' DNA-binding domain and PF00098: Zinc
           knuckle
          Length = 201

 Score = 36.3 bits (80), Expect = 0.016
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGF-EAAGVTGPGGEPVKGS 419
           +D+FVHQ++I      +  RS+   E+VEF V     G  +A  V+GP G PV+G+
Sbjct: 38  DDLFVHQSSIRS----EGFRSLAAEESVEFDVEVDNSGRPKAIEVSGPDGAPVQGN 89



 Score = 32.3 bits (70), Expect = 0.26
 Identities = 11/23 (47%), Positives = 17/23 (73%)
 Frame = +1

Query: 181 EKVSGTVKWFNVKSGYGFINRND 249
           ++  GTVKWF+ + G+GFI  +D
Sbjct: 13  DRRKGTVKWFDTQKGFGFITPSD 35


>At3g45830.1 68416.m04960 expressed protein
          Length = 1298

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 3/82 (3%)
 Frame = +3

Query: 210  QRQEWIWFHQQE*HQEDVFVHQTAIARN--NPRK-AVRSVGDGEAVEFAVVAGEKGFEAA 380
            +R+ W++ H+    QED     T+  +    P+K A     + EAV  A +  E+  E  
Sbjct: 1161 ERKLWVYLHRDR-EQEDFEDDGTSSTKKWKRPKKEAAEQTEEQEAVTVAFLGNEEQTE-- 1217

Query: 381  GVTGPGGEPVKGSPYAADKRRG 446
              T  G EP  G P   D  +G
Sbjct: 1218 --TEMGSEPKTGEPTGLDGDQG 1237


>At4g18740.2 68417.m02770 expressed protein 
          Length = 214

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 10/27 (37%), Positives = 15/27 (55%)
 Frame = +1

Query: 205 WFNVKSGYGFINRNDTKKMCLCIRLPS 285
           WF  K G  + +   +KK C+C + PS
Sbjct: 57  WFQEKGGSSYTSMGRSKKGCVCCKKPS 83


>At4g18740.1 68417.m02769 expressed protein 
          Length = 245

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 10/27 (37%), Positives = 15/27 (55%)
 Frame = +1

Query: 205 WFNVKSGYGFINRNDTKKMCLCIRLPS 285
           WF  K G  + +   +KK C+C + PS
Sbjct: 57  WFQEKGGSSYTSMGRSKKGCVCCKKPS 83


>At2g33620.3 68415.m04122 DNA-binding family protein / AT-hook
           protein 1 (AHP1) identical to AT-hook protein 1
           [Arabidopsis thaliana] gi|2598227|emb|CAA10857
          Length = 351

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 19/49 (38%), Positives = 24/49 (48%)
 Frame = +3

Query: 315 SVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRRGYHRQY 461
           S G+   +   +  GE G    G+TG G EPVK       KRRG  R+Y
Sbjct: 69  SAGENSVLNMNLPGGESG----GMTGTGSEPVK-------KRRGRPRKY 106


>At2g33620.2 68415.m04121 DNA-binding family protein / AT-hook
           protein 1 (AHP1) identical to AT-hook protein 1
           [Arabidopsis thaliana] gi|2598227|emb|CAA10857
          Length = 351

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 19/49 (38%), Positives = 24/49 (48%)
 Frame = +3

Query: 315 SVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRRGYHRQY 461
           S G+   +   +  GE G    G+TG G EPVK       KRRG  R+Y
Sbjct: 69  SAGENSVLNMNLPGGESG----GMTGTGSEPVK-------KRRGRPRKY 106


>At2g33620.1 68415.m04120 DNA-binding family protein / AT-hook
           protein 1 (AHP1) identical to AT-hook protein 1
           [Arabidopsis thaliana] gi|2598227|emb|CAA10857
          Length = 351

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 19/49 (38%), Positives = 24/49 (48%)
 Frame = +3

Query: 315 SVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRRGYHRQY 461
           S G+   +   +  GE G    G+TG G EPVK       KRRG  R+Y
Sbjct: 69  SAGENSVLNMNLPGGESG----GMTGTGSEPVK-------KRRGRPRKY 106


>At1g25540.1 68414.m03171 phytochrome and flowering time regulatory
           protein (PFT1) PMID: 12815435
          Length = 836

 Score = 27.9 bits (59), Expect = 5.6
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +1

Query: 208 FNVKSGYGFINRNDTKKMCLCIRLPS 285
           F   S +GF+ +   KK+C  I+LPS
Sbjct: 623 FRAMSQHGFLGQLQDKKLCAVIQLPS 648


>At5g50800.1 68418.m06293 nodulin MtN3 family protein similar to
           MtN3 GI:1619602 (root nodule development) from [Medicago
           truncatula]
          Length = 294

 Score = 27.5 bits (58), Expect = 7.4
 Identities = 11/24 (45%), Positives = 17/24 (70%)
 Frame = +1

Query: 283 SPVTTHVRLCARSATERRWSLPWL 354
           +PV T VR+C + +TE   SLP++
Sbjct: 26  APVPTFVRICKKKSTEGFQSLPYV 49


>At5g45190.1 68418.m05547 cyclin family protein similar to cyclin T1
           [Equus caballus] GI:5052355; contains Pfam profile
           PF00134: Cyclin, N-terminal domain
          Length = 579

 Score = 27.5 bits (58), Expect = 7.4
 Identities = 11/19 (57%), Positives = 13/19 (68%)
 Frame = -3

Query: 66  GERRWWQRW*NTPRPLLDV 10
           GE+ WWQ +  TPR L DV
Sbjct: 241 GEKVWWQEFDVTPRQLEDV 259


>At4g19600.1 68417.m02880 cyclin family protein similar to cyclin
           T2a [Homo sapiens] GI:2981198; contains Pfam profile
           PF00134: Cyclin, N-terminal domain
          Length = 541

 Score = 27.5 bits (58), Expect = 7.4
 Identities = 11/19 (57%), Positives = 13/19 (68%)
 Frame = -3

Query: 66  GERRWWQRW*NTPRPLLDV 10
           GE+ WWQ +  TPR L DV
Sbjct: 241 GEKVWWQEFDVTPRQLEDV 259


>At2g39650.1 68415.m04862 expressed protein contains Pfam profile
           PF04720: Protein of unknown function (DUF506)
          Length = 291

 Score = 27.5 bits (58), Expect = 7.4
 Identities = 20/58 (34%), Positives = 29/58 (50%)
 Frame = -1

Query: 485 SSATLTREILAVVATALVCSIR*AFYWLTTGTSNTSCFKAFLPGNHGKLHRLSVADRA 312
           S A    E+L+VV T ++       + + +GT N SC + +L     KL RLS  D A
Sbjct: 73  SMAQHETEVLSVVRTLMLTIKEKDLHSVKSGTCNASCIRFYL----AKLLRLSGYDAA 126


>At2g17870.1 68415.m02070 cold-shock DNA-binding family protein
           contains Pfam domains, PF00313: 'Cold-shock' DNA-binding
           domain and PF00098: Zinc knuckle
          Length = 301

 Score = 27.1 bits (57), Expect = 9.7
 Identities = 11/24 (45%), Positives = 14/24 (58%)
 Frame = +1

Query: 178 AEKVSGTVKWFNVKSGYGFINRND 249
           A +  G V WF+   GYGFI  +D
Sbjct: 8   AARSIGKVSWFSDGKGYGFITPDD 31


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,782,772
Number of Sequences: 28952
Number of extensions: 170264
Number of successful extensions: 561
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 544
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 561
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1216725696
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -