SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30115.Seq
         (690 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g03340.1 68418.m00286 cell division cycle protein 48, putativ...   116   1e-26
At3g09840.1 68416.m01174 cell division cycle protein 48 (CDC48A)...   116   1e-26
At3g53230.1 68416.m05865 cell division cycle protein 48, putativ...   111   4e-25
At4g13885.1 68417.m02151 3'-5' exonuclease-related contains weak...    31   0.95 
At3g26630.1 68416.m03328 pentatricopeptide (PPR) repeat-containi...    30   1.3  
At1g30750.1 68414.m03758 expressed protein                             30   1.3  
At3g10160.1 68416.m01218 dihydrofolate synthetase/folylpolygluta...    29   2.9  
At2g46430.1 68415.m05778 cyclic nucleotide-regulated ion channel...    29   2.9  
At1g31060.1 68414.m03802 expressed protein similar to EST gb|T43267    29   2.9  
At5g50220.1 68418.m06220 F-box family protein contains F-box dom...    28   5.1  
At5g05980.1 68418.m00662 dihydrofolate synthetase/folylpolygluta...    28   5.1  
At2g46440.1 68415.m05779 cyclic nucleotide-regulated ion channel...    28   5.1  
At2g14120.2 68415.m01573 dynamin-like protein 2b (ADL2b) identic...    28   6.7  
At2g14120.1 68415.m01572 dynamin-like protein 2b (ADL2b) identic...    28   6.7  
At5g10520.1 68418.m01218 protein kinase family protein contains ...    27   8.9  
At1g49400.1 68414.m05537 ribosomal protein S17 family protein si...    27   8.9  

>At5g03340.1 68418.m00286 cell division cycle protein 48, putative /
           CDC48, putative very strong similarity to SP|P54609 Cell
           division cycle protein 48 homolog {Arabidopsis
           thaliana}; contains Pfam profiles PF00004: ATPase AAA
           family, PF02359: Cell division protein 48 (CDC48)
           N-terminal domain; supporting cDNA
           gi|26449351|dbj|AK117125.1|
          Length = 810

 Score =  116 bits (280), Expect = 1e-26
 Identities = 49/85 (57%), Positives = 62/85 (72%)
 Frame = +2

Query: 257 LSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTGNLF 436
           L+D+ C + KIRM             DV+S+  CP VKYGKRVHILP+DD+VEG+TGNLF
Sbjct: 76  LADETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLF 135

Query: 437 EVYLKPYFMEAYRPIHRDDTFMVRG 511
           + YLKPYF+EAYRP+ + D F+VRG
Sbjct: 136 DAYLKPYFLEAYRPVRKGDLFLVRG 160



 Score = 99.1 bits (236), Expect = 2e-21
 Identities = 44/67 (65%), Positives = 57/67 (85%)
 Frame = +3

Query: 54  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 233
           +D+K+  D STAIL RK  PNRL+V+EA++DDNSVV+L    ME+LQLFRGDT+L+KGK+
Sbjct: 8   SDSKTKKDFSTAILERKKSPNRLVVDEAINDDNSVVSLHPTTMEKLQLFRGDTILIKGKK 67

Query: 234 RKETVCI 254
           RK+TVCI
Sbjct: 68  RKDTVCI 74



 Score = 93.1 bits (221), Expect = 2e-19
 Identities = 39/57 (68%), Positives = 50/57 (87%)
 Frame = +1

Query: 511 GMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           GMR+VEFKV+ETDP+ +C+VAPDT I C+GEP+KRE+EE  L+ VGYDD+GG RKQ+
Sbjct: 161 GMRSVEFKVIETDPAEYCVVAPDTEIFCEGEPVKREDEER-LDEVGYDDVGGVRKQM 216


>At3g09840.1 68416.m01174 cell division cycle protein 48 (CDC48A)
           (CDC48) identical to SP|P54609 Cell division cycle
           protein 48 homolog {Arabidopsis thaliana}
          Length = 809

 Score =  116 bits (280), Expect = 1e-26
 Identities = 49/85 (57%), Positives = 62/85 (72%)
 Frame = +2

Query: 257 LSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTGNLF 436
           L+D+ C + KIRM             DV+S+  CP VKYGKRVHILP+DD+VEG+TGNLF
Sbjct: 76  LADETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLF 135

Query: 437 EVYLKPYFMEAYRPIHRDDTFMVRG 511
           + YLKPYF+EAYRP+ + D F+VRG
Sbjct: 136 DAYLKPYFLEAYRPVRKGDLFLVRG 160



 Score =  101 bits (243), Expect = 3e-22
 Identities = 46/67 (68%), Positives = 58/67 (86%)
 Frame = +3

Query: 54  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 233
           +D+KS  D STAIL RK  PNRL+V+EA++DDNSVV+L  A ME+LQLFRGDT+L+KGK+
Sbjct: 8   SDSKSKKDFSTAILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKK 67

Query: 234 RKETVCI 254
           RK+TVCI
Sbjct: 68  RKDTVCI 74



 Score = 92.7 bits (220), Expect = 2e-19
 Identities = 39/57 (68%), Positives = 50/57 (87%)
 Frame = +1

Query: 511 GMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           GMR+VEFKV+ETDP+ +C+VAPDT I C+GEP+KRE+EE  L+ VGYDD+GG RKQ+
Sbjct: 161 GMRSVEFKVIETDPAEYCVVAPDTEIFCEGEPVKREDEER-LDDVGYDDVGGVRKQM 216


>At3g53230.1 68416.m05865 cell division cycle protein 48, putative /
           CDC48, putative very strong similarity to SP|P54609 Cell
           division cycle protein 48 homolog {Arabidopsis
           thaliana}; contains Pfam profiles PF00004: ATPase AAA
           family, PF02359: Cell division protein 48 (CDC48)
           N-terminal domain
          Length = 815

 Score =  111 bits (267), Expect = 4e-25
 Identities = 45/85 (52%), Positives = 61/85 (71%)
 Frame = +2

Query: 257 LSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTGNLF 436
           L+D+ C + KIRM             DV+S+  CP VKYG RVHILP+DD++EG++GN+F
Sbjct: 77  LADETCDEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGNRVHILPLDDTIEGVSGNIF 136

Query: 437 EVYLKPYFMEAYRPIHRDDTFMVRG 511
           + YLKPYF+EAYRP+ + D F+VRG
Sbjct: 137 DAYLKPYFLEAYRPVRKGDLFLVRG 161



 Score = 93.1 bits (221), Expect = 2e-19
 Identities = 39/57 (68%), Positives = 50/57 (87%)
 Frame = +1

Query: 511 GMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           GMR++EFKV+ETDP+ +C+VAPDT I C+GEPIKRE+EE  L+ VGYDD+GG RKQ+
Sbjct: 162 GMRSIEFKVIETDPAEYCVVAPDTEIFCEGEPIKREDEER-LDEVGYDDVGGVRKQM 217



 Score = 89.4 bits (212), Expect = 2e-18
 Identities = 42/68 (61%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +3

Query: 54  ADNK-SPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGK 230
           +D+K +  D STAIL +K   NRL+V+EA++DDNSVV+L    ME+LQLFRGDT+L+KGK
Sbjct: 8   SDSKGTKKDFSTAILEKKKAANRLVVDEAINDDNSVVSLHPDTMEKLQLFRGDTILIKGK 67

Query: 231 RRKETVCI 254
           +RK+TVCI
Sbjct: 68  KRKDTVCI 75


>At4g13885.1 68417.m02151 3'-5' exonuclease-related contains weak
           similarity to Pfam domain PF01612: 3'-5' exonuclease
          Length = 263

 Score = 30.7 bits (66), Expect = 0.95
 Identities = 13/23 (56%), Positives = 18/23 (78%)
 Frame = -2

Query: 206 TTEELKLLHFGL*KCHD*VVIAD 138
           TTEELK+ H+ L KC D +V+A+
Sbjct: 3   TTEELKISHYKLYKCFDFLVVAN 25


>At3g26630.1 68416.m03328 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile: PF01535 PPR repeat
          Length = 455

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = -3

Query: 361 RTRSDGYHIRKTHTKVVSHNTVHPNFLIRAII 266
           RT S+   +++ HTK++ HN  +   L+R +I
Sbjct: 28  RTCSNFSQLKQIHTKIIKHNLTNDQLLVRQLI 59


>At1g30750.1 68414.m03758 expressed protein
          Length = 212

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/59 (23%), Positives = 28/59 (47%)
 Frame = +1

Query: 91  SSVARTDPTVSLSKKQSAMTTQSWHFHRPKWSNFNSSVVTQSCSRANAARKPFASALRR 267
           SS    +P +      S++      F++P  + FN  + + S S ++A  +PF + L +
Sbjct: 115 SSTGLNNPILGQPSTSSSLNQPLTGFNQPSSTGFNQPISSSSSSSSSAQNQPFTNRLNQ 173


>At3g10160.1 68416.m01218 dihydrofolate
           synthetase/folylpolyglutamate synthetase (DHFS/FPGS3)
           nearly identical to gi:17976757
          Length = 464

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 10/18 (55%), Positives = 13/18 (72%)
 Frame = -1

Query: 534 FELDGAHAPRTMKVSSRW 481
           F LDGAH+P +M+   RW
Sbjct: 250 FYLDGAHSPESMEACGRW 267


>At2g46430.1 68415.m05778 cyclic nucleotide-regulated ion channel /
           cyclic nucleotide-gated channel (CNGC3) identical to
           cyclic nucleotide and calmodulin-regulated ion channel
           GI:4581201 from [Arabidopsis thaliana]
          Length = 706

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 21/68 (30%), Positives = 28/68 (41%), Gaps = 2/68 (2%)
 Frame = +1

Query: 490 RHLHGPRGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIK--REEEEEALNAVGYDDIG 663
           R LH  +      F  V+      C +      HC  +  K  REEE +  N +  DD G
Sbjct: 592 RRLHSKQLRHMFRFYSVQWQTWAACFIQAAWKRHCRRKLSKALREEEGKLHNTLQNDDSG 651

Query: 664 GCRKQLGA 687
           G +  LGA
Sbjct: 652 GNKLNLGA 659


>At1g31060.1 68414.m03802 expressed protein similar to EST gb|T43267
          Length = 106

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 11/20 (55%), Positives = 12/20 (60%)
 Frame = +2

Query: 500 MVRGACAPSSSKWSKQIHHH 559
           M+R  C PSSS W    HHH
Sbjct: 1   MLREECTPSSSWWEDVQHHH 20


>At5g50220.1 68418.m06220 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 357

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 18/78 (23%), Positives = 34/78 (43%), Gaps = 2/78 (2%)
 Frame = -1

Query: 594 TVYYGIRSHDAKW*WICFDHF--ELDGAHAPRTMKVSSRWIGR*ASMKYGFKYTSNRLPV 421
           T+YY  + + + +  +CFD    + D   AP+TM +  R+       K GF    NR+ +
Sbjct: 206 TIYYQAKQYGSTYVLLCFDVISEKFDQVEAPKTM-MDHRYTLINYQGKLGFMCCQNRVEI 264

Query: 420 RPSTESSIGSMWTRFPYF 367
                      W++  ++
Sbjct: 265 WVMKNDEKKQEWSKIFFY 282


>At5g05980.1 68418.m00662 dihydrofolate
           synthetase/folylpolyglutamate synthetase (DHFS/FPGS2)
           nearly identical to gi:17976705; identical to cDNA
           dihydrofolate synthetase/folylpolyglutamate synthetase
           (dhfs/fpgs2 gene) GI:17976704
          Length = 571

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 9/18 (50%), Positives = 14/18 (77%)
 Frame = -1

Query: 534 FELDGAHAPRTMKVSSRW 481
           F LDGAH+P +M+  ++W
Sbjct: 382 FYLDGAHSPESMEACAKW 399


>At2g46440.1 68415.m05779 cyclic nucleotide-regulated ion channel,
           putative (CNGC11) similar to cyclic nucleotide and
           calmodulin-regulated ion channel (cngc3) GI:4581201 from
           [Arabidopsis thaliana]
          Length = 588

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 20/68 (29%), Positives = 28/68 (41%), Gaps = 2/68 (2%)
 Frame = +1

Query: 490 RHLHGPRGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIK--REEEEEALNAVGYDDIG 663
           R LH  +      F  ++      C +      HC  +  K  REEE +  N +  DD G
Sbjct: 517 RRLHSKQLQHMFRFYSLQWQTWAACFIQAAWKRHCRRKLSKALREEEGKLHNTLQNDDSG 576

Query: 664 GCRKQLGA 687
           G +  LGA
Sbjct: 577 GNKLNLGA 584


>At2g14120.2 68415.m01573 dynamin-like protein 2b (ADL2b) identical
           to dynamin like protein 2b (ADL2b) [Arabidopsis
           thaliana] GI:19032339
          Length = 780

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 13/27 (48%), Positives = 16/27 (59%)
 Frame = -3

Query: 304 NTVHPNFLIRAIIV*EQMQTVSLRRLP 224
           NT HPNF+     V + MQTV   R+P
Sbjct: 508 NTSHPNFIGGTKAVEQAMQTVKSSRIP 534


>At2g14120.1 68415.m01572 dynamin-like protein 2b (ADL2b) identical
           to dynamin like protein 2b (ADL2b) [Arabidopsis
           thaliana] GI:19032339
          Length = 780

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 13/27 (48%), Positives = 16/27 (59%)
 Frame = -3

Query: 304 NTVHPNFLIRAIIV*EQMQTVSLRRLP 224
           NT HPNF+     V + MQTV   R+P
Sbjct: 508 NTSHPNFIGGTKAVEQAMQTVKSSRIP 534


>At5g10520.1 68418.m01218 protein kinase family protein contains
           protein kinase domain, INTERPRO:IPR000719
          Length = 467

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +1

Query: 49  KWQIIKALMIYR-PRSSVARTDPTVSLSKKQSAMTTQSWHFHRPKWSNF 192
           ++ +I  L  Y   R ++ R  P   L+  +SA T +++   +P W NF
Sbjct: 95  RFSVIPLLASYELTRKNLRRKQP--KLTPSESAFTCEAFFMAKPSWRNF 141


>At1g49400.1 68414.m05537 ribosomal protein S17 family protein
           similar to 40S ribosomal protein S17 GI:1620985 from
           [Nicotiana plumbaginifolia]
          Length = 116

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 18/44 (40%), Positives = 23/44 (52%)
 Frame = +1

Query: 28  SNNKF*IKWQIIKALMIYRPRSSVARTDPTVSLSKKQSAMTTQS 159
           S NK  I  +IIK   IY P+++ A    + S S   SA TT S
Sbjct: 64  SKNKHWIVAEIIKKARIYSPKAAAAAVSASASAS---SASTTDS 104


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,270,404
Number of Sequences: 28952
Number of extensions: 320853
Number of successful extensions: 902
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 877
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 899
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1467502800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -