SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30111.Seq
         (593 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g20050.1 68416.m02536 T-complex protein 1 alpha subunit / TCP...   130   9e-31
At5g20890.1 68418.m02481 chaperonin, putative similar to SWISS-P...    89   2e-18
At3g03960.1 68416.m00415 chaperonin, putative similar to SWISS-P...    78   4e-15
At3g11830.1 68416.m01450 chaperonin, putative similar to SWISS-P...    77   1e-14
At5g26360.1 68418.m03151 chaperonin, putative similar to SWISS-P...    74   8e-14
At3g18190.1 68416.m02314 chaperonin, putative similar to SWISS-P...    73   1e-13
At1g24510.1 68414.m03086 T-complex protein 1 epsilon subunit, pu...    68   4e-12
At1g24510.2 68414.m03085 T-complex protein 1 epsilon subunit, pu...    67   1e-11
At5g16070.1 68418.m01878 chaperonin, putative similar to SWISS-P...    57   8e-09
At3g02530.1 68416.m00241 chaperonin, putative similar to SWISS-P...    56   1e-08
At5g18820.1 68418.m02236 chaperonin, putative similar to SWISS-P...    43   1e-04
At2g28000.1 68415.m03393 RuBisCO subunit binding-protein alpha s...    36   0.020
At5g56500.1 68418.m07051 chaperonin, putative similar to SWISS-P...    34   0.062
At3g13470.1 68416.m01695 chaperonin, putative similar SWISS-PROT...    33   0.14 
At1g55490.2 68414.m06348 RuBisCO subunit binding-protein beta su...    33   0.19 
At1g55490.1 68414.m06347 RuBisCO subunit binding-protein beta su...    33   0.19 
At1g26230.1 68414.m03200 chaperonin, putative similar to SWISS-P...    31   0.44 
At2g16400.1 68415.m01877 homeodomain-containing protein                29   2.3  
At2g33210.1 68415.m04069 chaperonin, putative similar to SWISS-P...    28   5.4  
At3g50090.1 68416.m05476 exonuclease family protein contains exo...    27   9.4  
At2g46640.1 68415.m05818 hypothetical protein  and genefinder; e...    27   9.4  

>At3g20050.1 68416.m02536 T-complex protein 1 alpha subunit /
           TCP-1-alpha / chaperonin (CCT1) identical to
           SWISS-PROT:P28769- T-complex protein 1, alpha subunit
           (TCP-1-alpha) [Arabidopsis thaliana]
          Length = 545

 Score =  130 bits (313), Expect = 9e-31
 Identities = 63/92 (68%), Positives = 76/92 (82%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +EVEHPAAKVLVELA+LQD EVGDGTTSVVI+AAELLK A++LV+ KIHPTSIISGY
Sbjct: 65  LRMLEVEHPAAKVLVELAELQDREVGDGTTSVVIVAAELLKRANDLVRNKIHPTSIISGY 124

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLITQPK 520
           RLA +E+ KYI++ L   VE LG+  LI   K
Sbjct: 125 RLAMRESCKYIEEKLVTKVEKLGKVPLINCAK 156



 Score = 89.4 bits (212), Expect = 2e-18
 Identities = 44/67 (65%), Positives = 50/67 (74%)
 Frame = +3

Query: 54  MSTIAAPLSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNE 233
           MS  A    ++G R  G  VRTQNVM      NIVK+SLGPVGLDKMLVDDIGDVT+TN+
Sbjct: 1   MSISAQNPDISGDRQSGQDVRTQNVMACQAVSNIVKTSLGPVGLDKMLVDDIGDVTITND 60

Query: 234 GATILKM 254
           GATIL+M
Sbjct: 61  GATILRM 67



 Score = 37.5 bits (83), Expect = 0.007
 Identities = 16/24 (66%), Positives = 21/24 (87%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDA 585
           AKT+MSSKLI  D+DFF+ +VV+A
Sbjct: 155 AKTSMSSKLISGDSDFFANLVVEA 178


>At5g20890.1 68418.m02481 chaperonin, putative similar to
           SWISS-PROT:P78371- T-complex protein 1, beta subunit
           (TCP-1-beta) [Homo sapiens]; contains Pfam:PF00118
           domain, TCP-1/cpn60 chaperonin family
          Length = 527

 Score = 89.4 bits (212), Expect = 2e-18
 Identities = 37/63 (58%), Positives = 58/63 (92%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K++ +++PAAKVLV+++++QD+EVGDGTTSVV++A ELL+ A++LV +KIHP +II+GY
Sbjct: 66  LKSLHIDNPAAKVLVDISKVQDDEVGDGTTSVVVLAGELLREAEKLVASKIHPMTIIAGY 125

Query: 425 RLA 433
           R+A
Sbjct: 126 RMA 128



 Score = 40.7 bits (91), Expect = 7e-04
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 3/53 (5%)
 Frame = +3

Query: 102 GDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIG---DVTVTNEGATILK 251
           G+  R  + +      ++VKS+LGP G+DK+L    G    VTVTN+GATILK
Sbjct: 16  GERARMASFVGAMAISDLVKSTLGPKGMDKIL-QSTGRGHAVTVTNDGATILK 67



 Score = 29.5 bits (63), Expect = 1.8
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDA 585
           A TT+ SK++  D + F+EM VDA
Sbjct: 158 AMTTLCSKILSQDKEHFAEMAVDA 181


>At3g03960.1 68416.m00415 chaperonin, putative similar to
           SWISS-PROT:P42932- T-complex protein 1, theta subunit
           (TCP-1-theta) [Mus musculus]; contains Pfam:PF00118
           domain, TCP-1/cpn60 chaperonin family
          Length = 549

 Score = 78.2 bits (184), Expect = 4e-15
 Identities = 34/82 (41%), Positives = 55/82 (67%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  +E++HPAAK+LV  A+ Q EE+GDG    +  A ELL+NA+EL++  +HP+ IISGY
Sbjct: 73  VNELEIQHPAAKLLVLAAKAQQEEIGDGANLTISFAGELLQNAEELIRMGLHPSEIISGY 132

Query: 425 RLACKEAVKYIQDNLTVTVESL 490
             A  +AV+ ++  +    E++
Sbjct: 133 TKAVSKAVEILEQLVETGSETM 154



 Score = 36.7 bits (81), Expect = 0.012
 Identities = 16/48 (33%), Positives = 29/48 (60%)
 Frame = +3

Query: 105 DPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           D    +N+        I ++SLGP G++KM+++ +  + VTN+ ATI+
Sbjct: 26  DEAVIKNIEACKELSTITRTSLGPNGMNKMVINHLDKLFVTNDAATIV 73


>At3g11830.1 68416.m01450 chaperonin, putative similar to
           SWISS-PROT:P80313 T-complex protein 1, eta subunit
           (TCP-1-eta) [Mus musculus]; contains Pfam:PF00118
           domain, TCP-1/cpn60 chaperonin family
          Length = 557

 Score = 76.6 bits (180), Expect = 1e-14
 Identities = 35/80 (43%), Positives = 57/80 (71%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +++ HPAAK+LV++A+ QD EVGDGTT+VV++AAE LK A   ++  +H  ++I  Y
Sbjct: 69  MKLLDIVHPAAKILVDIAKSQDSEVGDGTTTVVLLAAEFLKEAKPFIEDGVHAQNLIRSY 128

Query: 425 RLACKEAVKYIQDNLTVTVE 484
           R A   A+  +++ L V++E
Sbjct: 129 RTASTLAIAKVKE-LAVSIE 147



 Score = 49.2 bits (112), Expect = 2e-06
 Identities = 21/53 (39%), Positives = 35/53 (66%)
 Frame = +3

Query: 96  SCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           S G      N+       ++V+++LGP G+DK++ DD G VT++N+GATI+K+
Sbjct: 19  SQGKAQLVSNINACTAVGDVVRTTLGPRGMDKLIHDDKGSVTISNDGATIMKL 71



 Score = 36.3 bits (80), Expect = 0.015
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDA 585
           A TT+SSKLIG + +FF+ MVVDA
Sbjct: 162 AATTLSSKLIGGEKEFFATMVVDA 185


>At5g26360.1 68418.m03151 chaperonin, putative similar to
           SWISS-PROT:P50143- T-complex protein 1, gamma subunit
           (TCP-1-gamma) [Xenopus laevis]; contains Pfam:PF00118
           domain, TCP-1/cpn60 chaperonin family
          Length = 555

 Score = 73.7 bits (173), Expect = 8e-14
 Identities = 32/88 (36%), Positives = 59/88 (67%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V HPAAK ++EL++ QDEEVGDGTTSV+++A E+L  A+  ++   HPT I   Y
Sbjct: 65  LRELDVAHPAAKSMIELSRTQDEEVGDGTTSVIVLAGEMLHVAEAFLEKNYHPTVICRAY 124

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLI 508
             A ++++  + D + ++++   R  ++
Sbjct: 125 IKALEDSIA-VLDKIAMSIDINDRSQVL 151



 Score = 40.7 bits (91), Expect = 7e-04
 Identities = 21/59 (35%), Positives = 33/59 (55%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           LS +  R  G  V   N+       +I++++LGP  + KML+D  G + VTN+G  IL+
Sbjct: 8   LSDSLKRESGSKVHHGNIQASKAVADIIRTTLGPRSMLKMLLDAGGGIVVTNDGNAILR 66


>At3g18190.1 68416.m02314 chaperonin, putative similar to
           SWISS-PROT:P50991- T-complex protein 1, delta subunit
           (TCP-1-delta) [Homo sapiens]; contains Pfam:PF00118
           domain, TCP-1/cpn60 chaperonin family
          Length = 536

 Score = 72.9 bits (171), Expect = 1e-13
 Identities = 40/88 (45%), Positives = 52/88 (59%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  +EV  PAAK+LVEL++ QD   GDGTT+VV+IA  LLK    L+   IHPT I    
Sbjct: 74  LNKMEVLQPAAKMLVELSKSQDSAAGDGTTTVVVIAGALLKECQSLLTNGIHPTVISDSL 133

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLI 508
             AC +A+  I   + V VE   R SL+
Sbjct: 134 HKACGKAID-ILTAMAVPVELTDRDSLV 160



 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 23/58 (39%), Positives = 35/58 (60%)
 Frame = +3

Query: 105 DPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKMWKWSILLP 278
           + +R  N+       + V++SLGP G+DKM+    G+V +TN+GATIL   K  +L P
Sbjct: 27  EDIRFANINSARAVSDAVRTSLGPKGMDKMISTANGEVIITNDGATILN--KMEVLQP 82


>At1g24510.1 68414.m03086 T-complex protein 1 epsilon subunit,
           putative / TCP-1-epsilon, putative / chaperonin,
           putative identical to SWISS-PROT:O04450- T-complex
           protein 1, epsilon subunit (TCP-1-epsilon) [Arabidopsis
           thaliana]; strong similarity to SP|P54411 T-complex
           protein 1, epsilon subunit (TCP-1-epsilon) (CCT-epsilon)
           (TCP-K36) {Avena sativa}; contains Pfam:PF00118 domain,
           TCP-1/cpn60 chaperonin family
          Length = 535

 Score = 68.1 bits (159), Expect = 4e-12
 Identities = 29/72 (40%), Positives = 51/72 (70%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V++  AK++VEL++ QD E+GDGTT VV++A  LL+ A+  +   IHP  I  GY
Sbjct: 74  LEQMDVDNQIAKLMVELSRSQDYEIGDGTTGVVVMAGALLEQAERQLDRGIHPIRIAEGY 133

Query: 425 RLACKEAVKYIQ 460
            +A + AV++++
Sbjct: 134 EMASRVAVEHLE 145



 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 25/54 (46%), Positives = 34/54 (62%)
 Frame = +3

Query: 90  TRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           TR  G   +  N+        I++SSLGP G+DKML    GD+T+TN+GATIL+
Sbjct: 22  TRLRGIDAQKANIAAGKAVARILRSSLGPKGMDKMLQGPDGDITITNDGATILE 75


>At1g24510.2 68414.m03085 T-complex protein 1 epsilon subunit,
           putative / TCP-1-epsilon, putative / chaperonin,
           putative identical to SWISS-PROT:O04450- T-complex
           protein 1, epsilon subunit (TCP-1-epsilon) [Arabidopsis
           thaliana]; strong similarity to SP|P54411 T-complex
           protein 1, epsilon subunit (TCP-1-epsilon) (CCT-epsilon)
           (TCP-K36) {Avena sativa}; contains Pfam:PF00118 domain,
           TCP-1/cpn60 chaperonin family
          Length = 459

 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 29/69 (42%), Positives = 49/69 (71%)
 Frame = +2

Query: 254 VEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLA 433
           ++V++  AK++VEL++ QD E+GDGTT VV++A  LL+ A+  +   IHP  I  GY +A
Sbjct: 1   MDVDNQIAKLMVELSRSQDYEIGDGTTGVVVMAGALLEQAERQLDRGIHPIRIAEGYEMA 60

Query: 434 CKEAVKYIQ 460
            + AV++++
Sbjct: 61  SRVAVEHLE 69


>At5g16070.1 68418.m01878 chaperonin, putative similar to
           SWISS-PROT:P80317 T-complex protein 1, zeta subunit
           (TCP-1-zeta) [Mus musculus]; contains Pfam:PF00118
           domain, TCP-1/cpn60 chaperonin family
          Length = 535

 Score = 57.2 bits (132), Expect = 8e-09
 Identities = 24/79 (30%), Positives = 47/79 (59%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +++++P A ++   A  QD+  GDGTTS VI   EL+K ++  +   +HP  ++ G+
Sbjct: 63  LKEMQIQNPTAIMIARTAVAQDDISGDGTTSTVIFIGELMKQSERCIDEGMHPRVLVDGF 122

Query: 425 RLACKEAVKYIQDNLTVTV 481
            +A +  ++++ DN    V
Sbjct: 123 EIAKRATLQFL-DNFKTPV 140



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 17/34 (50%), Positives = 25/34 (73%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +++KS+LGP G  KMLV   GD+ +T +G T+LK
Sbjct: 31  DVLKSNLGPKGTIKMLVGGSGDIKLTKDGNTLLK 64


>At3g02530.1 68416.m00241 chaperonin, putative similar to
           SWISS-PROT:P80317- T-complex protein 1, zeta subunit
           (TCP-1-zeta) [Mus musculus]; contains Pfam:PF00118
           domain, TCP-1/cpn60 chaperonin family
          Length = 535

 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 23/79 (29%), Positives = 46/79 (58%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +++++P A ++   A  QD+  GDGTTS VI   EL+K ++  +   +HP  ++ G+
Sbjct: 63  LKEMQIQNPTAIMIARTAVAQDDISGDGTTSTVIFIGELMKQSERCIDEGMHPRVLVDGF 122

Query: 425 RLACKEAVKYIQDNLTVTV 481
            +A +  ++++    T  V
Sbjct: 123 EIAKRATLQFLDTFKTPVV 141



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 17/34 (50%), Positives = 25/34 (73%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +++KS+LGP G  KMLV   GD+ +T +G T+LK
Sbjct: 31  DVLKSNLGPKGTIKMLVGGSGDIKLTKDGNTLLK 64


>At5g18820.1 68418.m02236 chaperonin, putative similar to
           SWISS-PROT:P08926- RuBisCO subunit binding-protein alpha
           subunit, chloroplast precursor (60 kDa chaperonin alpha
           subunit, CPN-60 alpha)[Pisum sativum]; contains
           Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family
          Length = 575

 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 20/67 (29%), Positives = 37/67 (55%)
 Frame = +2

Query: 260 VEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACK 439
           +E+  A ++ E+A   +E  GDGTT+ +I+A E++K     +    +  S+ +G     K
Sbjct: 97  IENAGATLIQEVAIKMNESAGDGTTTAIILAREMIKAGSLAIAFGANAVSVKNGMNKTVK 156

Query: 440 EAVKYIQ 460
           E V+ +Q
Sbjct: 157 ELVRVLQ 163


>At2g28000.1 68415.m03393 RuBisCO subunit binding-protein alpha
           subunit, chloroplast / 60 kDa chaperonin alpha subunit /
           CPN-60 alpha identical to SWISS-PROT:P21238- RuBisCO
           subunit binding-protein alpha subunit, chloroplast
           precursor (60 kDa chaperonin alpha subunit, CPN-60
           alpha) [Arabidopsis thaliana]
          Length = 586

 Score = 35.9 bits (79), Expect = 0.020
 Identities = 18/67 (26%), Positives = 37/67 (55%)
 Frame = +2

Query: 260 VEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACK 439
           +E+  A ++ E+A   ++  GDGTT+  I+A E++K+    V +  +P S+  G     +
Sbjct: 110 MENAGAALIREVASKTNDSAGDGTTTASILAREIIKHGLLSVTSGANPVSLKRGIDKTVQ 169

Query: 440 EAVKYIQ 460
             ++ +Q
Sbjct: 170 GLIEELQ 176


>At5g56500.1 68418.m07051 chaperonin, putative similar to
           SWISS-PROT:P08927- RuBisCO subunit binding-protein beta
           subunit, chloroplast precursor (60 kDa chaperonin beta
           subunit, CPN-60 beta) [Pisum sativum]; contains
           Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family
          Length = 597

 Score = 34.3 bits (75), Expect = 0.062
 Identities = 19/63 (30%), Positives = 32/63 (50%)
 Frame = +2

Query: 260 VEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACK 439
           VE+  AK++ + A   ++  GDGTT+ V++A  L+    ++V    +P  I  G     K
Sbjct: 117 VENIGAKLVRQAASKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTTK 176

Query: 440 EAV 448
             V
Sbjct: 177 ALV 179


>At3g13470.1 68416.m01695 chaperonin, putative similar
           SWISS-PROT:P21240- RuBisCO subunit binding-protein beta
           subunit, chloroplast precursor (60 kDa chaperonin beta
           subunit, CPN-60 beta) [Arabidopsis thaliana]; contains
           Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family
          Length = 596

 Score = 33.1 bits (72), Expect = 0.14
 Identities = 18/67 (26%), Positives = 33/67 (49%)
 Frame = +2

Query: 260 VEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACK 439
           VE+  AK++ + A   ++  GDGTT+ V++A   +    ++V    +P  I  G     K
Sbjct: 117 VENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGFIAEGVKVVAAGANPVLITRGIEKTAK 176

Query: 440 EAVKYIQ 460
             V  ++
Sbjct: 177 ALVNELK 183


>At1g55490.2 68414.m06348 RuBisCO subunit binding-protein beta
           subunit, chloroplast / 60 kDa chaperonin beta subunit /
           CPN-60 beta identical to SWISS-PROT:P21240- RuBisCO
           subunit binding-protein beta subunit, chloroplast
           precursor (60 kDa chaperonin beta subunit, CPN-60 beta)
           [Arabidopsis thaliana]
          Length = 600

 Score = 32.7 bits (71), Expect = 0.19
 Identities = 18/63 (28%), Positives = 31/63 (49%)
 Frame = +2

Query: 260 VEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACK 439
           VE+  AK++ + A   ++  GDGTT+ V++A   +    ++V    +P  I  G     K
Sbjct: 121 VENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGFIAEGVKVVAAGANPVLITRGIEKTAK 180

Query: 440 EAV 448
             V
Sbjct: 181 ALV 183


>At1g55490.1 68414.m06347 RuBisCO subunit binding-protein beta
           subunit, chloroplast / 60 kDa chaperonin beta subunit /
           CPN-60 beta identical to SWISS-PROT:P21240- RuBisCO
           subunit binding-protein beta subunit, chloroplast
           precursor (60 kDa chaperonin beta subunit, CPN-60 beta)
           [Arabidopsis thaliana]
          Length = 600

 Score = 32.7 bits (71), Expect = 0.19
 Identities = 18/63 (28%), Positives = 31/63 (49%)
 Frame = +2

Query: 260 VEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACK 439
           VE+  AK++ + A   ++  GDGTT+ V++A   +    ++V    +P  I  G     K
Sbjct: 121 VENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGFIAEGVKVVAAGANPVLITRGIEKTAK 180

Query: 440 EAV 448
             V
Sbjct: 181 ALV 183


>At1g26230.1 68414.m03200 chaperonin, putative similar to
           SWISS-PROT:P08927- RuBisCO subunit binding-protein beta
           subunit, chloroplast precursor (60 kDa chaperonin beta
           subunit, CPN-60 beta) [Pisum sativum]; contains
           Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family
          Length = 611

 Score = 31.5 bits (68), Expect = 0.44
 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 4/72 (5%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQ----DEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSI 412
           +K +E+E P   V V+L +      ++  GDG+T+ +I+A  L+    +++    +P  +
Sbjct: 96  LKEIELEDPLENVGVKLVRQAGAKTNDLAGDGSTTSIILAHGLITEGIKVISAGTNPIQV 155

Query: 413 ISGYRLACKEAV 448
             G     K  V
Sbjct: 156 ARGIEKTTKALV 167


>At2g16400.1 68415.m01877 homeodomain-containing protein
          Length = 482

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 18/63 (28%), Positives = 33/63 (52%)
 Frame = +1

Query: 388 DQDPSNKHYLRIPSRL*RSSQVHSG*PHSNSRVTWQAVSDHTAKTTMSSKLIGADADFFS 567
           DQ+ ++++   +  RL  SSQ+ +   ++N+    Q VS  T +T  +SK + A  +   
Sbjct: 71  DQEDNDRNRFPVMRRLGLSSQIETSRGNNNNEYATQVVSGFT-RTIHNSKYLKAAQELLD 129

Query: 568 EMV 576
           E V
Sbjct: 130 ETV 132


>At2g33210.1 68415.m04069 chaperonin, putative similar to
           SWISS-PROT:Q05046- chaperonin CPN60-2, mitochondrial
           precursor (HSP60-2) [Cucurbita maxima]; contains
           Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family
          Length = 585

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 13/67 (19%), Positives = 31/67 (46%)
 Frame = +2

Query: 260 VEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACK 439
           +++  A ++ ++A   ++  GDGTT   ++   +     + V   ++   +  G +LA  
Sbjct: 97  IKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVD 156

Query: 440 EAVKYIQ 460
             V  +Q
Sbjct: 157 TVVTNLQ 163


>At3g50090.1 68416.m05476 exonuclease family protein contains
           exonuclease domain, Pfam:PF00929
          Length = 322

 Score = 27.1 bits (57), Expect = 9.4
 Identities = 13/30 (43%), Positives = 15/30 (50%)
 Frame = +2

Query: 56  VDYSCTFVCSRDKILRRPSENTKCNGSSGY 145
           +D S  F     + LRRPS NT C    GY
Sbjct: 162 IDTSLVFKYPNSRKLRRPSLNTLCMSVLGY 191


>At2g46640.1 68415.m05818 hypothetical protein  and genefinder;
           expression supported by MPSS
          Length = 310

 Score = 27.1 bits (57), Expect = 9.4
 Identities = 9/27 (33%), Positives = 16/27 (59%)
 Frame = +2

Query: 299 QLQDEEVGDGTTSVVIIAAELLKNADE 379
           ++ D+E G G    V+I   ++KN D+
Sbjct: 65  EMDDDECGSGDLDYVVIDGSIIKNVDQ 91


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,349,155
Number of Sequences: 28952
Number of extensions: 236846
Number of successful extensions: 577
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 548
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 576
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1180950720
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -