SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30110.Seq
         (444 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g26230.1 68417.m03776 60S ribosomal protein L31 (RPL31B) ribo...   102   1e-22
At5g56710.1 68418.m07078 60S ribosomal protein L31 (RPL31C)            99   7e-22
At2g19740.1 68415.m02306 60S ribosomal protein L31 (RPL31A)            99   1e-21
At4g17250.1 68417.m02594 expressed protein                             28   2.5  
At3g19400.2 68416.m02460 cysteine proteinase, putative non-conse...    28   2.5  
At3g19400.1 68416.m02461 cysteine proteinase, putative non-conse...    28   2.5  
At5g07150.1 68418.m00815 leucine-rich repeat family protein cont...    27   4.3  
At3g51220.1 68416.m05607 expressed protein contains Pfam doamin ...    27   4.3  
At5g40170.1 68418.m04875 disease resistance family protein conta...    27   5.7  
At1g32900.1 68414.m04053 starch synthase, putative similar to st...    27   5.7  
At3g43960.1 68416.m04706 cysteine proteinase, putative contains ...    26   10.0 

>At4g26230.1 68417.m03776 60S ribosomal protein L31 (RPL31B)
           ribosomal protein L31, Nicotiana glutinosa, U23784
          Length = 119

 Score =  102 bits (244), Expect = 1e-22
 Identities = 46/66 (69%), Positives = 56/66 (84%)
 Frame = +2

Query: 56  ERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLN 235
           E+KG+    EVVTREYT+NLH+RLH   FKK+AP+AIKEIRKFAEK+MGT D+RVD +LN
Sbjct: 3   EKKGRK--EEVVTREYTINLHRRLHSCTFKKKAPKAIKEIRKFAEKEMGTKDVRVDVKLN 60

Query: 236 KFLWSK 253
           K +WSK
Sbjct: 61  KQIWSK 66



 Score = 31.9 bits (69), Expect = 0.20
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTY--VPVASIKGLQTENVD 396
           G+R  P           NDDED+  + F+LVT   +P   + GL T+ ++
Sbjct: 67  GIRGPPRRIRVRVARKRNDDEDAKEEFFSLVTVAEIPAEGLSGLGTKIIE 116


>At5g56710.1 68418.m07078 60S ribosomal protein L31 (RPL31C)
          Length = 119

 Score =   99 bits (238), Expect = 7e-22
 Identities = 45/66 (68%), Positives = 55/66 (83%)
 Frame = +2

Query: 56  ERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLN 235
           E+KG+    EV+TREYT+NLH+RLH   FKK+AP+AIKEIRKFAEK MGT D+RVD +LN
Sbjct: 3   EKKGRK--EEVITREYTINLHRRLHKCTFKKKAPKAIKEIRKFAEKAMGTKDVRVDVKLN 60

Query: 236 KFLWSK 253
           K +WSK
Sbjct: 61  KQIWSK 66



 Score = 31.9 bits (69), Expect = 0.20
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTY--VPVASIKGLQTENVD 396
           G+R  P           NDDED+  + F+LVT   +P   + GL T+ ++
Sbjct: 67  GIRGPPRRIRVRVARKRNDDEDAKEEFFSLVTVAEIPAEGLSGLGTKVIE 116


>At2g19740.1 68415.m02306 60S ribosomal protein L31 (RPL31A)
          Length = 119

 Score = 99.1 bits (236), Expect = 1e-21
 Identities = 45/64 (70%), Positives = 51/64 (79%)
 Frame = +2

Query: 62  KGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKF 241
           KGK    EVVTREYT+NLH+RLH   FKK+AP AIKEIRKFA K MGT D+RVD +LNK 
Sbjct: 3   KGKGRKEEVVTREYTINLHRRLHSCTFKKKAPNAIKEIRKFALKAMGTKDVRVDVKLNKQ 62

Query: 242 LWSK 253
           +WSK
Sbjct: 63  IWSK 66



 Score = 32.3 bits (70), Expect = 0.15
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 2/53 (3%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTY--VPVASIKGLQTENVDASQ 405
           G+R  P           NDDED+  + F+LVT   +P   + GL T+ ++  +
Sbjct: 67  GIRGPPRRIRVRVARKRNDDEDAKEEFFSLVTVAEIPAEGLSGLGTKVIEEEE 119


>At4g17250.1 68417.m02594 expressed protein
          Length = 416

 Score = 28.3 bits (60), Expect = 2.5
 Identities = 13/40 (32%), Positives = 22/40 (55%)
 Frame = +2

Query: 104 TVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVD 223
           TV   KR   + +KKR   A+K+   + E++ G P ++ D
Sbjct: 169 TVPATKRFLELKYKKRYEFALKQCPSYTERRRGVPKLKED 208


>At3g19400.2 68416.m02460 cysteine proteinase, putative
           non-consensus AT acceptor site at exon 3; contains
           similarity to cysteine protease CYP1 GI:2828252, TDI-65
           GI:5726641 from [Lycopersicon esculentum]
          Length = 290

 Score = 28.3 bits (60), Expect = 2.5
 Identities = 13/48 (27%), Positives = 24/48 (50%)
 Frame = +2

Query: 98  EYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKF 241
           ++ V   K  +G+G K+R  +  K+  KF ++    PD   +  L +F
Sbjct: 46  QWLVENRKNYNGLGEKERRFKIFKDNLKFVDEHNSVPDRTFEVGLTRF 93


>At3g19400.1 68416.m02461 cysteine proteinase, putative
           non-consensus AT acceptor site at exon 3; contains
           similarity to cysteine protease CYP1 GI:2828252, TDI-65
           GI:5726641 from [Lycopersicon esculentum]
          Length = 362

 Score = 28.3 bits (60), Expect = 2.5
 Identities = 13/48 (27%), Positives = 24/48 (50%)
 Frame = +2

Query: 98  EYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKF 241
           ++ V   K  +G+G K+R  +  K+  KF ++    PD   +  L +F
Sbjct: 46  QWLVENRKNYNGLGEKERRFKIFKDNLKFVDEHNSVPDRTFEVGLTRF 93


>At5g07150.1 68418.m00815 leucine-rich repeat family protein
           contains weak similarity to LRR receptor-like protein
           kinase [Nicotiana tabacum] gi|7672732|gb|AAF66615;
           contains Pfam PF00560 domain Leucine Rich Repeat
          Length = 553

 Score = 27.5 bits (58), Expect = 4.3
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = +2

Query: 2   FFFFWYTKLKITMAKPKGERKGKSAINEVVT 94
           FFF W  K+K+   KP GE      + +VVT
Sbjct: 250 FFFLWNQKVKLI--KPWGETGSSGQLQDVVT 278


>At3g51220.1 68416.m05607 expressed protein contains Pfam doamin
           PF05701: Plant protein of unknown function (DUF827)
          Length = 186

 Score = 27.5 bits (58), Expect = 4.3
 Identities = 16/71 (22%), Positives = 31/71 (43%)
 Frame = +2

Query: 29  KITMAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTP 208
           K  + K + E K  S + E +T+E      K  H +      P+   +++   E  +  P
Sbjct: 53  KENLKKAEEENKVLSQLIESLTQELETTKEKLNHSLRNFPEHPQVEDDLKFIEESTVNEP 112

Query: 209 DIRVDTRLNKF 241
           D   + ++N+F
Sbjct: 113 DNITEIKMNRF 123


>At5g40170.1 68418.m04875 disease resistance family protein contains
           leucine rich-repeat (LRR) domains Pfam:PF00560,
           INTERPRO:IPR001611; similar to Cf-4 [Lycopersicon
           hirsutum] gi|2808683|emb|CAA05268
          Length = 792

 Score = 27.1 bits (57), Expect = 5.7
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +2

Query: 215 RVDTRLNKFLWSKESEMFPSVS 280
           R+DTR N   W+K+S+ F  VS
Sbjct: 62  RMDTRANISSWTKDSDSFSGVS 83


>At1g32900.1 68414.m04053 starch synthase, putative similar to
           starch synthase SP:Q42857 from [Ipomoea batatas]
          Length = 610

 Score = 27.1 bits (57), Expect = 5.7
 Identities = 14/55 (25%), Positives = 26/55 (47%)
 Frame = +2

Query: 56  ERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRV 220
           E+KG   + E +++   +N+   + G G KK   + ++   KF  K +G     V
Sbjct: 412 EQKGSDILVEAISKFMGLNVQMVILGTGKKKMEAQILELEEKFPGKAVGVAKFNV 466


>At3g43960.1 68416.m04706 cysteine proteinase, putative contains
           similarity to cysteine proteinase RD21A (thiol protease)
           GI:435619, SP:P43297 from [Arabidopsis thaliana]
          Length = 376

 Score = 26.2 bits (55), Expect = 10.0
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
 Frame = +2

Query: 83  EVVT--REYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKF 241
           EV+T   ++ V   K  +G+G K+R  +  K+  K  E+    P+   +  LNKF
Sbjct: 36  EVLTMYEQWLVENGKNYNGLGEKERRFKIFKDNLKRIEEHNSDPNRSYERGLNKF 90


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,992,812
Number of Sequences: 28952
Number of extensions: 164393
Number of successful extensions: 363
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 353
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 363
length of database: 12,070,560
effective HSP length: 75
effective length of database: 9,899,160
effective search space used: 712739520
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -