SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30108.Seq
         (591 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g46020.2 68415.m05725 transcription regulatory protein SNF2, ...    31   0.43 
At2g46020.1 68415.m05724 transcription regulatory protein SNF2, ...    31   0.43 
At3g49900.1 68416.m05455 BTB/POZ domain-containing protein conta...    28   5.4  
At5g46520.1 68418.m05728 disease resistance protein (TIR-NBS-LRR...    27   7.1  
At5g46510.1 68418.m05727 disease resistance protein (TIR-NBS-LRR...    27   7.1  
At4g10120.1 68417.m01655 sucrose-phosphate synthase, putative si...    27   9.4  

>At2g46020.2 68415.m05725 transcription regulatory protein SNF2,
            putative similar to SP|P22082 Transcription regulatory
            protein SNF2 (SWI/SNF complex component SNF2)
            {Saccharomyces cerevisiae}; contains Pfam profiles
            PF00271: Helicase conserved C-terminal domain, PF00176:
            SNF2 family N-terminal domain
          Length = 2193

 Score = 31.5 bits (68), Expect = 0.43
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +1

Query: 31   VWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEK 165
            +W ++ L L  VF   +A       PF ++ P H+IED  +E EK
Sbjct: 1148 LWSLLNLLLPDVFDNRKAFHDWFAQPFQKEGPAHNIEDDWLETEK 1192


>At2g46020.1 68415.m05724 transcription regulatory protein SNF2,
            putative similar to SP|P22082 Transcription regulatory
            protein SNF2 (SWI/SNF complex component SNF2)
            {Saccharomyces cerevisiae}; contains Pfam profiles
            PF00271: Helicase conserved C-terminal domain, PF00176:
            SNF2 family N-terminal domain
          Length = 2192

 Score = 31.5 bits (68), Expect = 0.43
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +1

Query: 31   VWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEK 165
            +W ++ L L  VF   +A       PF ++ P H+IED  +E EK
Sbjct: 1147 LWSLLNLLLPDVFDNRKAFHDWFAQPFQKEGPAHNIEDDWLETEK 1191


>At3g49900.1 68416.m05455 BTB/POZ domain-containing protein contains
           BTB/POZ domain, INTERPRO:IPR000210
          Length = 517

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 12/27 (44%), Positives = 18/27 (66%)
 Frame = +1

Query: 427 HITQTIKTSSSSACISPLLDVNLSHSP 507
           H + ++ +SSSS  +SP   +NLS SP
Sbjct: 22  HHSSSLSSSSSSLSLSPKQPINLSSSP 48


>At5g46520.1 68418.m05728 disease resistance protein (TIR-NBS-LRR
           class), putative domain signature TIR-NBS-LRR exists,
           suggestive of a disease resistance protein.
          Length = 1298

 Score = 27.5 bits (58), Expect = 7.1
 Identities = 16/70 (22%), Positives = 34/70 (48%)
 Frame = +1

Query: 79  RAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLNAQNCWIAALLYLITLVVSGHQFWLKI 258
           RA  +     F E +PP   E+ V+E+       A +  +   ++   L     ++W+K+
Sbjct: 390 RAQEMFCQSAFGENSPPEGFEELVVEI----AWLAGSLPLGLTVFGSALRGRKKEYWVKM 445

Query: 259 VPQLVCNIEG 288
           +P+L  +++G
Sbjct: 446 LPRLQNDLDG 455


>At5g46510.1 68418.m05727 disease resistance protein (TIR-NBS-LRR
           class), putative domain signature TIR-NBS-LRR exists,
           suggestive of a disease resistance protein.
          Length = 1353

 Score = 27.5 bits (58), Expect = 7.1
 Identities = 16/70 (22%), Positives = 34/70 (48%)
 Frame = +1

Query: 79  RAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLNAQNCWIAALLYLITLVVSGHQFWLKI 258
           RA  +     F E +PP   E+ V+E+       A +  +   ++   L     ++W+K+
Sbjct: 351 RAQEMFCQSAFGENSPPEGFEELVVEI----AWLAGSLPLGLTVFGSALRGRKKEYWVKM 406

Query: 259 VPQLVCNIEG 288
           +P+L  +++G
Sbjct: 407 LPRLQNDLDG 416


>At4g10120.1 68417.m01655 sucrose-phosphate synthase, putative
           similar to sucrose-phosphate synthase, Zea mays,
           PIR2:JQ1329; contains non-consensus (GC) donor splice
           site at intron 4
          Length = 1050

 Score = 27.1 bits (57), Expect = 9.4
 Identities = 9/17 (52%), Positives = 14/17 (82%)
 Frame = +2

Query: 86  SLCWRIYHLMRKIRLIL 136
           ++CWRI+HL RK + I+
Sbjct: 102 NICWRIWHLARKKKQIV 118


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,064,314
Number of Sequences: 28952
Number of extensions: 258670
Number of successful extensions: 657
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 642
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 654
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1171109464
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -