SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30107.Seq
         (684 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g70870.1 68414.m08176 major latex protein-related / MLP-relat...    29   2.9  
At5g45000.1 68418.m05518 Toll-Interleukin-Resistance (TIR) domai...    29   3.8  
At5g22545.1 68418.m02631 expressed protein                             28   5.0  
At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nic...    28   6.6  
At5g54020.1 68418.m06719 expressed protein                             27   8.8  
At3g19080.1 68416.m02423 SWIB complex BAF60b domain-containing p...    27   8.8  
At1g49520.1 68414.m05550 SWIB complex BAF60b domain-containing p...    27   8.8  

>At1g70870.1 68414.m08176 major latex protein-related / MLP-related
           low similarity to major latex protein {Papaver
           somniferum}[GI:294060] ; contains Pfam profile PF00407:
           Pathogenesis-related protein Bet v I family
          Length = 139

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = -1

Query: 678 TGFVRAGSSVENHVXLYCQKKRGPRGPSRRLTRWSW 571
           T FV  G  +EN+    C  +  P+   R + RWSW
Sbjct: 71  TVFVFEGDVMENYSSFTCNLQIIPKLHGRSIARWSW 106


>At5g45000.1 68418.m05518 Toll-Interleukin-Resistance (TIR)
           domain-containing protein domain signature TIR exists,
           suggestive of a disease resistance protein.
          Length = 371

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 11/17 (64%), Positives = 14/17 (82%)
 Frame = +2

Query: 440 TVPQKXGRSSAGHRDAS 490
           ++PQK G +SAGHRD S
Sbjct: 148 SIPQKIGLTSAGHRDES 164


>At5g22545.1 68418.m02631 expressed protein
          Length = 111

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 12/35 (34%), Positives = 22/35 (62%)
 Frame = +2

Query: 218 QKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQ 322
           +K+ Q+++K+EQSK +  P K   +    GIK+ +
Sbjct: 15  RKKQQKNKKKEQSKKQHTPVKTEDMVEPLGIKDDE 49


>At5g40340.1 68418.m04894 PWWP domain-containing protein KED,
           Nicotiana tabacum, EMBL:AB009883
          Length = 1008

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 18/58 (31%), Positives = 27/58 (46%)
 Frame = +2

Query: 191 KSARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRR 364
           K    GE  QKE   S K+E+ + + +  K        G +ETQ   S ++K E  R+
Sbjct: 741 KEGGEGEETQKEANESTKKERKRKKSESKK-----QSDGEEETQKEPSESTKKERKRK 793


>At5g54020.1 68418.m06719 expressed protein 
          Length = 556

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 11/25 (44%), Positives = 14/25 (56%)
 Frame = +1

Query: 28  DKMSPY*CAESNPITXKYCVIKSSR 102
           D  +PY C E N +  KYC+ K  R
Sbjct: 154 DDRNPYVCLECNLMVHKYCIEKLPR 178


>At3g19080.1 68416.m02423 SWIB complex BAF60b domain-containing
           protein contains Pfam profile PF02201: BAF60b domain of
           the SWIB complex
          Length = 462

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 19/64 (29%), Positives = 33/64 (51%)
 Frame = +2

Query: 209 EGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRRVRDLHARS 388
           E +++++ RS ++ + K   KPAK V  P RKG      V S + +++    V +L    
Sbjct: 231 EESEEQEVRSLRKRKRK---KPAKSVEKPKRKGGGGFAKVCSLSPELQAFTGVTELARTE 287

Query: 389 IVML 400
           +V L
Sbjct: 288 VVKL 291


>At1g49520.1 68414.m05550 SWIB complex BAF60b domain-containing
           protein contains Pfam profile PF02201: BAF60b domain of
           the SWIB complex
          Length = 372

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 14/33 (42%), Positives = 20/33 (60%)
 Frame = +2

Query: 209 EGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKG 307
           E  ++ED+  RKR++ K   KPAK    P +KG
Sbjct: 218 ESREEEDRSVRKRKRKKR--KPAKSEEKPKKKG 248


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,815,883
Number of Sequences: 28952
Number of extensions: 193677
Number of successful extensions: 552
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 529
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 551
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1447936096
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -