SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30104.Seq
         (674 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g08710.1 68418.m01035 regulator of chromosome condensation (R...    31   0.70 
At1g67720.1 68414.m07728 leucine-rich repeat family protein / pr...    30   1.2  
At5g60870.2 68418.m07635 regulator of chromosome condensation (R...    29   2.1  
At5g60870.1 68418.m07636 regulator of chromosome condensation (R...    29   2.1  
At1g19880.1 68414.m02493 regulator of chromosome condensation (R...    29   2.8  
At3g03790.2 68416.m00389 ankyrin repeat family protein / regulat...    29   3.8  
At3g03790.1 68416.m00388 ankyrin repeat family protein / regulat...    29   3.8  
At3g07900.1 68416.m00965 expressed protein contains Pfam PF03138...    28   5.0  

>At5g08710.1 68418.m01035 regulator of chromosome condensation
           (RCC1) family protein / UVB-resistance protein-related
           contains Pfam PF00415 : Regulator of chromosome
           condensation (RCC1); similar to UVB-resistance protein
           UVR8  (GI:10177674) {Arabidopsis thaliana}
          Length = 434

 Score = 31.1 bits (67), Expect = 0.70
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = +2

Query: 350 WHPMRSSFAERFDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIG 493
           W P   S      IT +ACG   T+     +E  +VF TG+N   Q+G
Sbjct: 71  WTPAVCSALSDHSITAVACGGAHTLF---LTETRRVFATGLNDCGQLG 115


>At1g67720.1 68414.m07728 leucine-rich repeat family protein /
           protein kinase family protein contains similarity to
           light repressible receptor protein kinase [Arabidopsis
           thaliana] gi|1321686|emb|CAA66376; contains Pfam doamins
           PF00069: Protein kinase domain and PF00560: Leucine Rich
           Repeat
          Length = 929

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = +3

Query: 285 WVSTSHVARKGKKVTKTTSNWFGIQ 359
           WVS S + ++GK VT   +NW  +Q
Sbjct: 46  WVSDSEIIKQGKPVTLANTNWNSMQ 70


>At5g60870.2 68418.m07635 regulator of chromosome condensation
           (RCC1) family protein weak similarity to UVB-resistance
           protein UVR8 [Arabidopsis thaliana] GI:5478530; contains
           Pfam profile PF00415: Regulator of chromosome
           condensation (RCC1)
          Length = 383

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 20/53 (37%), Positives = 25/53 (47%)
 Frame = +2

Query: 350 WHPMRSSFAERFDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPR 508
           W PM     E   IT IACG G+   S+  +E+ KV   G     Q+G  S R
Sbjct: 234 WEPMPVPSLEGVRITQIACG-GY--HSLALTEEGKVLSWGHGGHGQLGSSSLR 283



 Score = 28.7 bits (61), Expect = 3.8
 Identities = 9/26 (34%), Positives = 16/26 (61%)
 Frame = +3

Query: 567 AWECEIKAVAAGRAHTIILTDKEGVY 644
           +W+C+I A+A    HT  +T+   +Y
Sbjct: 132 SWDCKISAIATSGTHTAAITESGELY 157


>At5g60870.1 68418.m07636 regulator of chromosome condensation
           (RCC1) family protein weak similarity to UVB-resistance
           protein UVR8 [Arabidopsis thaliana] GI:5478530; contains
           Pfam profile PF00415: Regulator of chromosome
           condensation (RCC1)
          Length = 445

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 20/53 (37%), Positives = 25/53 (47%)
 Frame = +2

Query: 350 WHPMRSSFAERFDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPR 508
           W PM     E   IT IACG G+   S+  +E+ KV   G     Q+G  S R
Sbjct: 303 WEPMPVPSLEGVRITQIACG-GY--HSLALTEEGKVLSWGHGGHGQLGSSSLR 352



 Score = 28.7 bits (61), Expect = 3.8
 Identities = 9/26 (34%), Positives = 16/26 (61%)
 Frame = +3

Query: 567 AWECEIKAVAAGRAHTIILTDKEGVY 644
           +W+C+I A+A    HT  +T+   +Y
Sbjct: 201 SWDCKISAIATSGTHTAAITESGELY 226


>At1g19880.1 68414.m02493 regulator of chromosome condensation
           (RCC1) family protein low similarity to UVB-resistance
           protein UVR8 [Arabidopsis thaliana] GI:5478530; contains
           Pfam profile PF00415: Regulator of chromosome
           condensation (RCC1)
          Length = 538

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 13/42 (30%), Positives = 24/42 (57%)
 Frame = +2

Query: 386 DITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPRE 511
           ++TN+ACG  FTV  + ++E   +   G+    Q+G+ +  E
Sbjct: 168 EVTNVACGADFTV-WLSSTEGASILTAGLPQYGQLGHGTDNE 208


>At3g03790.2 68416.m00389 ankyrin repeat family protein / regulator
           of chromosome condensation (RCC1) family protein similar
           to hect domain and RLD 2 GB:NP_004658 [Homo sapiens];
           contains Pfam PF00415: Regulator of chromosome
           condensation (RCC1); contains Pfam PF00023: Ankyrin
           repeat; similar to rjs (GI:3414809) [Mus musculus];
           similar to  HERC2 (GI:4079809) [Homo sapiens]
          Length = 1081

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = +3

Query: 582 IKAVAAGRAHTIILTDKEGVYT 647
           +KAVAA + HT+I T+   VYT
Sbjct: 247 VKAVAAAKHHTVIATEGGDVYT 268


>At3g03790.1 68416.m00388 ankyrin repeat family protein / regulator
           of chromosome condensation (RCC1) family protein similar
           to hect domain and RLD 2 GB:NP_004658 [Homo sapiens];
           contains Pfam PF00415: Regulator of chromosome
           condensation (RCC1); contains Pfam PF00023: Ankyrin
           repeat; similar to rjs (GI:3414809) [Mus musculus];
           similar to  HERC2 (GI:4079809) [Homo sapiens]
          Length = 1078

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = +3

Query: 582 IKAVAAGRAHTIILTDKEGVYT 647
           +KAVAA + HT+I T+   VYT
Sbjct: 244 VKAVAAAKHHTVIATEGGDVYT 265


>At3g07900.1 68416.m00965 expressed protein contains Pfam PF03138:
           Plant protein family. The function of this family of
           plant proteins is unknown; previously annotated as
           'auxin-independent growth promoter -related'  based on
           similarity to axi 1 protein (GB:X80301) (GI:559920) from
           [Nicotiana tabacum], which, due to scienitific fraud was
           retracted. Retraction in: Schell J. EMBO J 1999 May
           17;18(10):2908. PMID:10400497.
          Length = 579

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 16/53 (30%), Positives = 25/53 (47%)
 Frame = +3

Query: 174 KKVHDPSEEELLPIFQYPISKSTDRRVMCGDLLRQVLWVSTSHVARKGKKVTK 332
           KK+  P++  +LP F       T+   M   L RQ L      +++ G+ VTK
Sbjct: 512 KKIITPNKRHMLPYFVNSSLTETEFEKMIKKLHRQSLGQPELRISKAGRDVTK 564


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,739,724
Number of Sequences: 28952
Number of extensions: 299736
Number of successful extensions: 706
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 672
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 705
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1432596384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -