SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30102.Seq
         (594 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g59850.1 68418.m07505 40S ribosomal protein S15A (RPS15aF) cy...   116   2e-26
At1g07770.2 68414.m00839 40S ribosomal protein S15A (RPS15aA) id...   116   2e-26
At1g07770.1 68414.m00838 40S ribosomal protein S15A (RPS15aA) id...   116   2e-26
At3g46040.1 68416.m04981 40S ribosomal protein S15A (RPS15aD) cy...   114   5e-26
At2g39590.1 68415.m04856 40S ribosomal protein S15A (RPS15aC)         111   4e-25
At2g19720.1 68415.m02304 40S ribosomal protein S15A (RPS15aB)          71   8e-13
At4g29430.1 68417.m04202 40S ribosomal protein S15A (RPS15aE) ri...    70   1e-12
At1g18390.1 68414.m02297 protein kinase family protein contains ...    29   3.1  
At1g76880.1 68414.m08946 trihelix DNA-binding protein, putative ...    27   9.4  

>At5g59850.1 68418.m07505 40S ribosomal protein S15A (RPS15aF)
           cytoplasmic ribosomal protein S15a, Arabidopsis
           thaliana, EMBL:ATAF1412
          Length = 130

 Score =  116 bits (278), Expect = 2e-26
 Identities = 54/69 (78%), Positives = 62/69 (89%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVR++VL+DALKS++NAEKRGKRQV+IRP SKVI+KFL VM  HGYIGEFE VDDHR+GK
Sbjct: 1   MVRISVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEYVDDHRSGK 60

Query: 283 IVVNLTGRL 257
           IVV L GRL
Sbjct: 61  IVVELNGRL 69



 Score = 79.4 bits (187), Expect = 2e-15
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWT-NLLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFDV + +IE WT  LLPSRQFGY+VL TS GIM HEEARR
Sbjct: 71  KCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARR 118


>At1g07770.2 68414.m00839 40S ribosomal protein S15A (RPS15aA)
           identical to GB:AAA61608 from [Arabidopsis thaliana]
           (Plant Physiol. 106 (1), 401-402 (1994))
          Length = 130

 Score =  116 bits (278), Expect = 2e-26
 Identities = 54/69 (78%), Positives = 62/69 (89%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVR++VL+DALKS++NAEKRGKRQV+IRP SKVI+KFL VM  HGYIGEFE VDDHR+GK
Sbjct: 1   MVRISVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEYVDDHRSGK 60

Query: 283 IVVNLTGRL 257
           IVV L GRL
Sbjct: 61  IVVELNGRL 69



 Score = 79.4 bits (187), Expect = 2e-15
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWT-NLLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFDV + +IE WT  LLPSRQFGY+VL TS GIM HEEARR
Sbjct: 71  KCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARR 118


>At1g07770.1 68414.m00838 40S ribosomal protein S15A (RPS15aA)
           identical to GB:AAA61608 from [Arabidopsis thaliana]
           (Plant Physiol. 106 (1), 401-402 (1994))
          Length = 130

 Score =  116 bits (278), Expect = 2e-26
 Identities = 54/69 (78%), Positives = 62/69 (89%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVR++VL+DALKS++NAEKRGKRQV+IRP SKVI+KFL VM  HGYIGEFE VDDHR+GK
Sbjct: 1   MVRISVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEYVDDHRSGK 60

Query: 283 IVVNLTGRL 257
           IVV L GRL
Sbjct: 61  IVVELNGRL 69



 Score = 79.4 bits (187), Expect = 2e-15
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWT-NLLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFDV + +IE WT  LLPSRQFGY+VL TS GIM HEEARR
Sbjct: 71  KCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARR 118


>At3g46040.1 68416.m04981 40S ribosomal protein S15A (RPS15aD)
           cytoplasmic ribosomal protein S15a, Arabidopsis
           thaliana, EMBL:ATAF1412
          Length = 130

 Score =  114 bits (274), Expect = 5e-26
 Identities = 53/69 (76%), Positives = 61/69 (88%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVR++VL+D LKS++NAEKRGKRQV+IRP SKVI+KFL VM  HGYIGEFE VDDHR+GK
Sbjct: 1   MVRISVLNDGLKSMYNAEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEYVDDHRSGK 60

Query: 283 IVVNLTGRL 257
           IVV L GRL
Sbjct: 61  IVVELNGRL 69



 Score = 77.8 bits (183), Expect = 5e-15
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWT-NLLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFDV + +IE WT  LLPSRQFG++VL TS GIM HEEARR
Sbjct: 71  KCGVISPRFDVGVKEIEGWTARLLPSRQFGFIVLTTSAGIMDHEEARR 118


>At2g39590.1 68415.m04856 40S ribosomal protein S15A (RPS15aC) 
          Length = 136

 Score =  111 bits (266), Expect = 4e-25
 Identities = 52/71 (73%), Positives = 60/71 (84%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVR +VL+D LKS+ NAEK+GKRQV+IRP SKVI+KFLTVM  HGYI EFE VDDHR+GK
Sbjct: 7   MVRASVLNDCLKSMSNAEKQGKRQVMIRPSSKVIIKFLTVMQKHGYIAEFEYVDDHRSGK 66

Query: 283 IVVNLTGRLKS 251
           IVV L GRL +
Sbjct: 67  IVVELNGRLNN 77



 Score = 73.7 bits (173), Expect = 8e-14
 Identities = 33/47 (70%), Positives = 39/47 (82%), Gaps = 1/47 (2%)
 Frame = -2

Query: 251 CGVISPRFDVPINDIERWT-NLLPSRQFGYLVLXTSGGIMXHEEARR 114
           CGVISPR+D+ + +IE WT  LLPSRQFGY+VL TS GIM HEEAR+
Sbjct: 78  CGVISPRYDLGVKEIEGWTAKLLPSRQFGYIVLTTSAGIMDHEEARK 124


>At2g19720.1 68415.m02304 40S ribosomal protein S15A (RPS15aB) 
          Length = 129

 Score = 70.5 bits (165), Expect = 8e-13
 Identities = 32/64 (50%), Positives = 45/64 (70%)
 Frame = -3

Query: 448 VLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGKIVVNL 269
           +L+DAL++I NAEKRGK  V ++P S V+  FL +M   GYI  F++ D HR G+I V+L
Sbjct: 5   ILNDALRTIVNAEKRGKASVELKPVSTVMSSFLKIMKEKGYIKNFQVHDPHRVGRITVDL 64

Query: 268 TGRL 257
            GR+
Sbjct: 65  QGRV 68



 Score = 45.2 bits (102), Expect = 3e-05
 Identities = 21/45 (46%), Positives = 31/45 (68%), Gaps = 1/45 (2%)
 Frame = -2

Query: 251 CGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEA 120
           C  ++ R DV  N+I ++T   LP+RQ+GY+V+ T  GI+ HEEA
Sbjct: 71  CKALTYRQDVKANEIGQYTERTLPTRQWGYIVITTPDGILDHEEA 115


>At4g29430.1 68417.m04202 40S ribosomal protein S15A (RPS15aE)
           ribosomal protein S15a - Brassica napus,PIR2:S20945
          Length = 129

 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 31/64 (48%), Positives = 45/64 (70%)
 Frame = -3

Query: 448 VLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGKIVVNL 269
           +L+DAL++I NAE+RGK  V ++P S V+  FL +M   GYI  F++ D HR G+I V+L
Sbjct: 5   ILNDALRTIVNAERRGKASVELKPISTVMSSFLRIMKEKGYIKNFQVYDPHRVGRITVDL 64

Query: 268 TGRL 257
            GR+
Sbjct: 65  QGRV 68



 Score = 45.2 bits (102), Expect = 3e-05
 Identities = 21/45 (46%), Positives = 31/45 (68%), Gaps = 1/45 (2%)
 Frame = -2

Query: 251 CGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEA 120
           C  ++ R DV   +IE++T   LP+RQ+GY+V+ T  GI+ HEEA
Sbjct: 71  CKALTYRQDVRAKEIEKYTERTLPTRQWGYVVITTPDGILDHEEA 115


>At1g18390.1 68414.m02297 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 605

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 11/36 (30%), Positives = 22/36 (61%)
 Frame = -3

Query: 385 IRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGKIV 278
           +RPC   +   LT +  +G+  E ++VD +++G +V
Sbjct: 556 LRPCMSHVQDTLTRIQNNGFGSEMDVVDVNKSGPLV 591


>At1g76880.1 68414.m08946 trihelix DNA-binding protein, putative
           similar to DNA-binding protein DF1 [Pisum sativum]
           GI:13646986
          Length = 603

 Score = 27.1 bits (57), Expect = 9.4
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +3

Query: 240 NDTTLFSLPVRFTTILPAL*SSTI 311
           N++++FS P   TT++P L SS+I
Sbjct: 177 NNSSIFSTPPPVTTVMPTLPSSSI 200


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,230,931
Number of Sequences: 28952
Number of extensions: 183507
Number of successful extensions: 309
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 289
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 304
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1180950720
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -