SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30101.Seq
         (454 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g19390.1 68416.m02459 cysteine proteinase, putative / thiol p...    30   0.64 
At5g67100.1 68418.m08460 DNA-directed DNA polymerase alpha catal...    29   1.9  
At4g11900.1 68417.m01893 S-locus lectin protein kinase family pr...    28   2.6  
At1g17590.3 68414.m02169 CCAAT-binding transcription factor (CBF...    28   2.6  
At1g17590.2 68414.m02168 CCAAT-binding transcription factor (CBF...    28   2.6  
At1g17590.1 68414.m02167 CCAAT-binding transcription factor (CBF...    28   2.6  
At1g08140.1 68414.m00896 cation/hydrogen exchanger (CHX6a) Note:...    28   3.4  
At3g06180.1 68416.m00710 expressed protein                             27   4.5  
At5g05110.1 68418.m00542 cysteine protease inhibitor, putative /...    27   7.8  

>At3g19390.1 68416.m02459 cysteine proteinase, putative / thiol
           protease, putative contains similarity to cysteine
           proteinase RD21A (thiol protease) GI:435619, SP:P43297
           from [Arabidopsis thaliana]
          Length = 452

 Score = 30.3 bits (65), Expect = 0.64
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +2

Query: 260 KHGGECFSKGYCSQSLIYEEASDCPEGXDCC 352
           ++ G+C+S G C     YE A+ C +G  CC
Sbjct: 380 EYNGKCYSWGCCP----YESATCCDDGSSCC 406


>At5g67100.1 68418.m08460 DNA-directed DNA polymerase alpha
           catalytic subunit, putative similar to SP|O48653 DNA
           polymerase alpha catalytic subunit (EC 2.7.7.7) {Oryza
           sativa}; contains Pfam profiles: PF03175 DNA polymerase
           type B, organellar and viral, PF00136 DNA polymerase
           family B, PF03104 DNA polymerase family B, exonuclease
           domain
          Length = 1492

 Score = 28.7 bits (61), Expect = 1.9
 Identities = 16/71 (22%), Positives = 32/71 (45%), Gaps = 1/71 (1%)
 Frame = -3

Query: 335 RDSLKLLHISKIDCSSLSRNILR-RASDSGLFYGHSVTAFDSVFLLLRTESSSGSDIRWT 159
           ++   +L I   + + L+R  L     DS +  GH+++ FD   LL R ++       W+
Sbjct: 637 KNGCNVLSIENSERALLNRLFLELNKLDSDILVGHNISGFDLDVLLQRAQACKVQSSMWS 696

Query: 158 VLSHSTQTTFP 126
            +    ++  P
Sbjct: 697 KIGRLKRSFMP 707


>At4g11900.1 68417.m01893 S-locus lectin protein kinase family
           protein contains Pfam domains, PF00954: S-locus
           glycoprotein family, PF00069: Protein kinase domain, and
           PF01453: Lectin (probable mannose binding)
          Length = 849

 Score = 28.3 bits (60), Expect = 2.6
 Identities = 13/43 (30%), Positives = 22/43 (51%)
 Frame = -3

Query: 221 FDSVFLLLRTESSSGSDIRWTVLSHSTQTTFPAARILLFNGIY 93
           FDS  L+LR   +S + + W    H + T  P  +I L + ++
Sbjct: 160 FDSGNLVLRDGPNSSAAVLWQSFDHPSDTWLPGGKIRLGSQLF 202


>At1g17590.3 68414.m02169 CCAAT-binding transcription factor
           (CBF-B/NF-YA) family protein contains Pfam profile:
           PF02045 CCAAT-binding transcription factor (CBF-B/NF-YA)
           subunit B
          Length = 328

 Score = 28.3 bits (60), Expect = 2.6
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = -3

Query: 323 KLLHISKIDCSSLSRNILRRASDSGLFYGHS 231
           +L + +  DCS+ SR+ +  ASDS   +GHS
Sbjct: 261 QLQNSNDCDCSTTSRSDITSASDSVNLFGHS 291


>At1g17590.2 68414.m02168 CCAAT-binding transcription factor
           (CBF-B/NF-YA) family protein contains Pfam profile:
           PF02045 CCAAT-binding transcription factor (CBF-B/NF-YA)
           subunit B
          Length = 328

 Score = 28.3 bits (60), Expect = 2.6
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = -3

Query: 323 KLLHISKIDCSSLSRNILRRASDSGLFYGHS 231
           +L + +  DCS+ SR+ +  ASDS   +GHS
Sbjct: 261 QLQNSNDCDCSTTSRSDITSASDSVNLFGHS 291


>At1g17590.1 68414.m02167 CCAAT-binding transcription factor
           (CBF-B/NF-YA) family protein contains Pfam profile:
           PF02045 CCAAT-binding transcription factor (CBF-B/NF-YA)
           subunit B
          Length = 328

 Score = 28.3 bits (60), Expect = 2.6
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = -3

Query: 323 KLLHISKIDCSSLSRNILRRASDSGLFYGHS 231
           +L + +  DCS+ SR+ +  ASDS   +GHS
Sbjct: 261 QLQNSNDCDCSTTSRSDITSASDSVNLFGHS 291


>At1g08140.1 68414.m00896 cation/hydrogen exchanger (CHX6a) Note:
           CHX6a and CHX6b were originally 1 gene but were split
           pased on alignments with other family members; may be a
           pseudogene and requires futher investigation; monovalent
           cation:proton antiporter family 2 (CPA2) member,
           PMID:11500563
          Length = 818

 Score = 27.9 bits (59), Expect = 3.4
 Identities = 21/80 (26%), Positives = 34/80 (42%), Gaps = 8/80 (10%)
 Frame = -3

Query: 296 CSSLSRNILRRASDSGLF--------YGHSVTAFDSVFLLLRTESSSGSDIRWTVLSHST 141
           C SL+     R  DS +         +  S++AF S+  LL+      S+     LS + 
Sbjct: 169 CGSLTFRYRERRGDSSILRMEYRLIIFLQSISAFTSIDTLLKDLQIKHSEFGRIALSGAM 228

Query: 140 QTTFPAARILLFNGIYFTEI 81
            T   A  +  FN IY+ ++
Sbjct: 229 VTDMLAFGVTFFNAIYYEKL 248


>At3g06180.1 68416.m00710 expressed protein 
          Length = 241

 Score = 27.5 bits (58), Expect = 4.5
 Identities = 16/36 (44%), Positives = 18/36 (50%)
 Frame = -1

Query: 181 LALISDGQSSATVHKPPSLRHGSSCSMESISQKSSS 74
           L L+SD + S T   PPS     S S  S S  SSS
Sbjct: 4   LLLLSDEEHSTTNSMPPSSSASRSASNHSSSSSSSS 39


>At5g05110.1 68418.m00542 cysteine protease inhibitor, putative /
           cystatin, putative similar to cysteine proteinase
           inhibitor [Glycine max] GI:1944342; contains Pfam
           profile PF00031: Cystatin domain
          Length = 232

 Score = 26.6 bits (56), Expect = 7.8
 Identities = 10/23 (43%), Positives = 17/23 (73%)
 Frame = -1

Query: 133 PSLRHGSSCSMESISQKSSSLFP 65
           P ++  +  +M+S+ QKS+SLFP
Sbjct: 162 PEVQEAAKHAMKSLQQKSNSLFP 184


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,467,492
Number of Sequences: 28952
Number of extensions: 175341
Number of successful extensions: 574
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 559
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 574
length of database: 12,070,560
effective HSP length: 75
effective length of database: 9,899,160
effective search space used: 742437000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -