SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30100.Seq
         (586 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g60640.2 68418.m07611 thioredoxin family protein similar to p...    82   3e-16
At5g60640.1 68418.m07610 thioredoxin family protein similar to p...    82   3e-16
At1g77510.1 68414.m09026 protein disulfide isomerase, putative s...    79   2e-15
At1g21750.2 68414.m02723 protein disulfide isomerase, putative s...    79   2e-15
At1g21750.1 68414.m02722 protein disulfide isomerase, putative s...    79   2e-15
At3g54960.1 68416.m06094 thioredoxin family protein similar to p...    77   9e-15
At1g52260.1 68414.m05897 thioredoxin family protein similar to p...    73   2e-13
At2g47470.2 68415.m05924 thioredoxin family protein similar to p...    69   2e-12
At2g47470.1 68415.m05925 thioredoxin family protein similar to p...    69   2e-12
At1g35620.1 68414.m04425 thioredoxin family protein similar to S...    66   2e-11
At3g16110.1 68416.m02035 thioredoxin family protein similar to p...    62   3e-10
At1g04980.1 68414.m00497 thioredoxin family protein similar to S...    58   3e-09
At2g32920.1 68415.m04036 thioredoxin family protein similar to S...    56   2e-08
At4g27080.1 68417.m03893 thioredoxin family protein contains Pfa...    48   5e-06
At2g01270.1 68415.m00040 thioredoxin family protein low similari...    42   3e-04
At1g15020.2 68414.m01795 thioredoxin family protein low similari...    41   5e-04
At1g15020.1 68414.m01794 thioredoxin family protein low similari...    41   5e-04
At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chlorop...    41   7e-04
At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa...    40   0.001
At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38...    39   0.002
At3g20560.1 68416.m02603 thioredoxin family protein contains Pfa...    39   0.003
At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-...    38   0.004
At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38...    38   0.007
At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P...    37   0.009
At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-...    37   0.009
At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-...    37   0.009
At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i...    37   0.009
At1g50950.1 68414.m05728 thioredoxin-related contains weak hit t...    36   0.015
At5g61440.1 68418.m07709 thioredoxin family protein low similari...    36   0.020
At4g04950.1 68417.m00719 thioredoxin family protein similar to P...    36   0.020
At1g34780.1 68414.m04329 protein disulfide isomerase-related con...    36   0.020
At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / P...    36   0.026
At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica...    35   0.035
At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa...    35   0.035
At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior...    35   0.035
At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa...    35   0.046
At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa...    35   0.046
At4g26160.1 68417.m03765 thioredoxin family protein low similari...    35   0.046
At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29...    34   0.080
At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29...    33   0.14 
At1g07700.3 68414.m00829 thioredoxin family protein low similari...    33   0.14 
At1g07700.2 68414.m00827 thioredoxin family protein low similari...    33   0.14 
At1g07700.1 68414.m00828 thioredoxin family protein low similari...    33   0.14 
At1g76760.1 68414.m08933 thioredoxin family protein similar to t...    33   0.19 
At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i...    33   0.19 
At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa...    32   0.24 
At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa...    31   0.57 
At3g19780.1 68416.m02504 expressed protein                             31   0.57 
At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te...    31   0.57 
At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-...    31   0.57 
At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i...    31   0.75 
At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i...    31   0.75 
At4g08930.1 68417.m01470 thioredoxin-related contains weak simil...    31   0.75 
At3g63440.1 68416.m07143 FAD-binding domain-containing protein /...    30   0.99 
At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa...    30   0.99 
At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa...    30   0.99 
At3g08710.1 68416.m01012 thioredoxin family protein similar to t...    29   1.7  
At1g52990.1 68414.m05997 thioredoxin family protein similar to S...    29   1.7  
At1g07960.3 68414.m00867 thioredoxin family protein low similari...    29   3.0  
At1g07960.2 68414.m00866 thioredoxin family protein low similari...    29   3.0  
At1g07960.1 68414.m00865 thioredoxin family protein low similari...    29   3.0  
At1g11530.1 68414.m01324 thioredoxin family protein similar to t...    28   4.0  
At4g16140.1 68417.m02445 proline-rich family protein contains pr...    28   5.3  
At2g27350.3 68415.m03293 OTU-like cysteine protease family prote...    28   5.3  
At2g27350.2 68415.m03292 OTU-like cysteine protease family prote...    28   5.3  
At2g27350.1 68415.m03291 OTU-like cysteine protease family prote...    28   5.3  
At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi...    27   7.0  
At2g29800.1 68415.m03620 kelch repeat-containing F-box family pr...    27   9.2  
At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa...    27   9.2  

>At5g60640.2 68418.m07611 thioredoxin family protein similar to
           protein disulfide isomerase GI:5902592 from [Volvox
           carteri f. nagariensis], GI:2708314 from Chlamydomonas
           reinhardtii; contains Pfam profile: PF00085 Thioredoxin
          Length = 536

 Score = 81.8 bits (193), Expect = 3e-16
 Identities = 33/81 (40%), Positives = 56/81 (69%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVT 435
           LAK+DAT+E +LA+ Y V+G+PTL FF +G    Y+GGR  + I++W+KKK GP    +T
Sbjct: 156 LAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGPGVYNLT 215

Query: 436 SAEQAKELIDANTVIVFGFFS 498
           + + A++++ +   +V G+ +
Sbjct: 216 TLDDAEKVLTSGNKVVLGYLN 236



 Score = 80.2 bits (189), Expect = 9e-16
 Identities = 37/66 (56%), Positives = 48/66 (72%), Gaps = 4/66 (6%)
 Frame = +2

Query: 56  LGLALGDEVPT----EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 223
           LG    D +PT    E++V+V+ + NF  VI   +Y+LVEFYAPWCGHC+SLAPEYA AA
Sbjct: 87  LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146

Query: 224 TKLAEE 241
           T+L E+
Sbjct: 147 TELKED 152



 Score = 51.6 bits (118), Expect = 4e-07
 Identities = 25/61 (40%), Positives = 38/61 (62%), Gaps = 3/61 (4%)
 Frame = +2

Query: 74  DEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 244
           D +P   +E+V ++   NF E V+  ++ +L+E YAPWCGHC++L P Y K A  L   +
Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLAKHLRSID 492

Query: 245 S 247
           S
Sbjct: 493 S 493


>At5g60640.1 68418.m07610 thioredoxin family protein similar to
           protein disulfide isomerase GI:5902592 from [Volvox
           carteri f. nagariensis], GI:2708314 from Chlamydomonas
           reinhardtii; contains Pfam profile: PF00085 Thioredoxin
          Length = 597

 Score = 81.8 bits (193), Expect = 3e-16
 Identities = 33/81 (40%), Positives = 56/81 (69%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVT 435
           LAK+DAT+E +LA+ Y V+G+PTL FF +G    Y+GGR  + I++W+KKK GP    +T
Sbjct: 156 LAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGPGVYNLT 215

Query: 436 SAEQAKELIDANTVIVFGFFS 498
           + + A++++ +   +V G+ +
Sbjct: 216 TLDDAEKVLTSGNKVVLGYLN 236



 Score = 80.2 bits (189), Expect = 9e-16
 Identities = 37/66 (56%), Positives = 48/66 (72%), Gaps = 4/66 (6%)
 Frame = +2

Query: 56  LGLALGDEVPT----EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 223
           LG    D +PT    E++V+V+ + NF  VI   +Y+LVEFYAPWCGHC+SLAPEYA AA
Sbjct: 87  LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146

Query: 224 TKLAEE 241
           T+L E+
Sbjct: 147 TELKED 152



 Score = 51.6 bits (118), Expect = 4e-07
 Identities = 25/61 (40%), Positives = 38/61 (62%), Gaps = 3/61 (4%)
 Frame = +2

Query: 74  DEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 244
           D +P   +E+V ++   NF E V+  ++ +L+E YAPWCGHC++L P Y K A  L   +
Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLAKHLRSID 492

Query: 245 S 247
           S
Sbjct: 493 S 493


>At1g77510.1 68414.m09026 protein disulfide isomerase, putative
           similar to protein disulfide isomerase precursor
           GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit:
           PF00085 Thioredoxins
          Length = 508

 Score = 79.4 bits (187), Expect = 2e-15
 Identities = 37/84 (44%), Positives = 59/84 (70%), Gaps = 4/84 (4%)
 Frame = +1

Query: 256 LAKVDATQE--QDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPA 423
           LAK+DA++E  ++ A  Y ++G+PTLK  RNG  S  DY+G R+A+ I+++LKK++GP +
Sbjct: 84  LAKIDASEEANKEFANEYKIQGFPTLKILRNGGKSVQDYNGPREAEGIVTYLKKQSGPAS 143

Query: 424 VEVTSAEQAKELIDANTVIVFGFF 495
           VE+ SA+ A E++    V+  G F
Sbjct: 144 VEIKSADSATEVVGEKNVVAVGVF 167



 Score = 74.5 bits (175), Expect = 5e-14
 Identities = 34/74 (45%), Positives = 48/74 (64%), Gaps = 2/74 (2%)
 Frame = +2

Query: 38  FTAIALLGLALGD--EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 211
           F+ + LL L +       T+E VL L  +NF   I+  ++I+VEFYAPWCGHC+ LAPEY
Sbjct: 9   FSILLLLSLFVSSIRSEETKEFVLTLDHSNFTETISKHDFIVVEFYAPWCGHCQKLAPEY 68

Query: 212 AKAATKLAEEESPI 253
            KAA++L+    P+
Sbjct: 69  EKAASELSSHNPPL 82



 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 3/61 (4%)
 Frame = +2

Query: 80  VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESP 250
           +P E N    +V++++  + V  + + +L+EFYAPWCGHC+ LAP   + A     + S 
Sbjct: 366 IPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPILDEVALSFQNDPSV 425

Query: 251 I 253
           I
Sbjct: 426 I 426



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 17/53 (32%), Positives = 35/53 (66%), Gaps = 1/53 (1%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKKT 411
           +AK+DAT     ++++ V+G+PT+ F   +G+ + Y G R  +D I++++K +
Sbjct: 427 IAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNS 479


>At1g21750.2 68414.m02723 protein disulfide isomerase, putative
           similar to SP|P29828 Protein disulfide isomerase
           precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform
           contains non-consensus GA donor splice site at intron 9
          Length = 487

 Score = 79.4 bits (187), Expect = 2e-15
 Identities = 36/84 (42%), Positives = 59/84 (70%), Gaps = 4/84 (4%)
 Frame = +1

Query: 256 LAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTGPPA 423
           LAK+DA++E  ++ A  Y V+G+PT+K FRNG     +Y+G R+A+ I+++LKK++GP +
Sbjct: 85  LAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSGPAS 144

Query: 424 VEVTSAEQAKELIDANTVIVFGFF 495
            E+ SA+ A E++    V+V G F
Sbjct: 145 AEIKSADDASEVVSDKKVVVVGIF 168



 Score = 79.0 bits (186), Expect = 2e-15
 Identities = 42/98 (42%), Positives = 55/98 (56%), Gaps = 6/98 (6%)
 Frame = +2

Query: 38  FTAIALLGLAL------GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 199
           FT  ++L L+L       +E  T+E VL L   NF   I   ++I+VEFYAPWCGHCK L
Sbjct: 6   FTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQL 65

Query: 200 APEYAKAATKLAEEESPIN*RKLTQLKNRISPRATVYE 313
           APEY KAA+ L+    P+   K+   +      AT YE
Sbjct: 66  APEYEKAASALSSNVPPVVLAKIDASEETNREFATQYE 103



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 3/61 (4%)
 Frame = +2

Query: 80  VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESP 250
           +P E N    +V+S +  + V+ + + +L+EFYAPWCGHC+ LAP   + A     + S 
Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSV 427

Query: 251 I 253
           +
Sbjct: 428 V 428



 Score = 35.1 bits (77), Expect = 0.035
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +1

Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLK 402
           S  +AK+DAT      +++ V+G+PT+ F   +G+ + Y G RQ + +  +++
Sbjct: 426 SVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRQRESLYLFIR 478


>At1g21750.1 68414.m02722 protein disulfide isomerase, putative
           similar to SP|P29828 Protein disulfide isomerase
           precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform
           contains non-consensus GA donor splice site at intron 9
          Length = 501

 Score = 79.4 bits (187), Expect = 2e-15
 Identities = 36/84 (42%), Positives = 59/84 (70%), Gaps = 4/84 (4%)
 Frame = +1

Query: 256 LAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTGPPA 423
           LAK+DA++E  ++ A  Y V+G+PT+K FRNG     +Y+G R+A+ I+++LKK++GP +
Sbjct: 85  LAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSGPAS 144

Query: 424 VEVTSAEQAKELIDANTVIVFGFF 495
            E+ SA+ A E++    V+V G F
Sbjct: 145 AEIKSADDASEVVSDKKVVVVGIF 168



 Score = 79.0 bits (186), Expect = 2e-15
 Identities = 42/98 (42%), Positives = 55/98 (56%), Gaps = 6/98 (6%)
 Frame = +2

Query: 38  FTAIALLGLAL------GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 199
           FT  ++L L+L       +E  T+E VL L   NF   I   ++I+VEFYAPWCGHCK L
Sbjct: 6   FTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQL 65

Query: 200 APEYAKAATKLAEEESPIN*RKLTQLKNRISPRATVYE 313
           APEY KAA+ L+    P+   K+   +      AT YE
Sbjct: 66  APEYEKAASALSSNVPPVVLAKIDASEETNREFATQYE 103



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 3/61 (4%)
 Frame = +2

Query: 80  VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESP 250
           +P E N    +V+S +  + V+ + + +L+EFYAPWCGHC+ LAP   + A     + S 
Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSV 427

Query: 251 I 253
           +
Sbjct: 428 V 428



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = +1

Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKK---TG 414
           S  +AK+DAT      +++ V+G+PT+ F   +G+ + Y G R  +D IS++ K     G
Sbjct: 426 SVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRTKEDFISFVDKNKDTVG 485

Query: 415 PPAVEVTSAEQAKE 456
            P  E  + E+ K+
Sbjct: 486 EPKKEEETTEEVKD 499


>At3g54960.1 68416.m06094 thioredoxin family protein similar to
           protein disulfide isomerase GI:5902592 from [Volvox
           carteri f. nagariensis], GI:2708314 from Chlamydomonas
           reinhardtii; contains Pfam profile: PF00085 Thioredoxin
          Length = 579

 Score = 77.0 bits (181), Expect = 9e-15
 Identities = 35/82 (42%), Positives = 53/82 (64%), Gaps = 1/82 (1%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVEV 432
           LAK+DAT+E DLA+ Y ++G+PT+  F +G     Y G R  D I++WLKKK  P    +
Sbjct: 151 LAKIDATEEGDLAQKYEIQGFPTVFLFVDGEMRKTYEGERTKDGIVTWLKKKASPSIHNI 210

Query: 433 TSAEQAKELIDANTVIVFGFFS 498
           T+ E+A+ ++ A   +VFGF +
Sbjct: 211 TTKEEAERVLSAEPKLVFGFLN 232



 Score = 63.7 bits (148), Expect = 9e-11
 Identities = 26/48 (54%), Positives = 35/48 (72%)
 Frame = +2

Query: 89  EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 232
           E++V VL+K NF   +    + +VEFYAPWCG C++L PEYA AAT+L
Sbjct: 98  EKDVAVLTKDNFTEFVGNNSFAMVEFYAPWCGACQALTPEYAAAATEL 145



 Score = 47.2 bits (107), Expect = 8e-06
 Identities = 27/72 (37%), Positives = 39/72 (54%), Gaps = 3/72 (4%)
 Frame = +2

Query: 11  DNIEMRVLIFTAIALLGLALGDEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWC 181
           +NI+     F A  L      D +P   + +V V+   NF E V+  ++ +L+E YAPWC
Sbjct: 408 NNIKTLAEDFLADKLKPFYKSDPLPENNDGDVKVIVGNNFDEIVLDESKDVLLEIYAPWC 467

Query: 182 GHCKSLAPEYAK 217
           GHC+S  P Y K
Sbjct: 468 GHCQSFEPIYNK 479


>At1g52260.1 68414.m05897 thioredoxin family protein similar to
           protein disulfide isomerase GI:5902592 from [Volvox
           carteri f. nagariensis], GI:2708314 from Chlamydomonas
           reinhardtii; contains Pfam profile: PF00085 Thioredoxin
          Length = 537

 Score = 72.5 bits (170), Expect = 2e-13
 Identities = 29/83 (34%), Positives = 49/83 (59%)
 Frame = +1

Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAV 426
           S  +AK+D  +   +A    ++G+PTL  F NG+ + Y+GG  A+DI+ W++KKTG P +
Sbjct: 129 SVLMAKIDGDRYSKIASELEIKGFPTLLLFVNGTSLTYNGGSSAEDIVIWVQKKTGAPII 188

Query: 427 EVTSAEQAKELIDANTVIVFGFF 495
            + + ++A   +D     V G F
Sbjct: 189 TLNTVDEAPRFLDKYHTFVLGLF 211



 Score = 41.9 bits (94), Expect = 3e-04
 Identities = 21/52 (40%), Positives = 29/52 (55%)
 Frame = +2

Query: 98  VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           VL L+    + VI   E+++V  YAPWC     L P +A+AAT L E  S +
Sbjct: 79  VLELNGDYTKRVIDGNEFVMVLGYAPWCARSAELMPRFAEAATALKEIGSSV 130


>At2g47470.2 68415.m05924 thioredoxin family protein similar to
           protein disulfide isomerase [Dictyostelium discoideum]
           GI:2627440; contains Pfam profile: PF00085 Thioredoxin
          Length = 266

 Score = 69.3 bits (162), Expect = 2e-12
 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%)
 Frame = +2

Query: 92  ENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           +NV+VL+  NF E V+   + +LVEFYAPWCGHCKSLAP Y K AT   +EE  +
Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVV 195



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 32/71 (45%), Positives = 42/71 (59%)
 Frame = +2

Query: 35  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 214
           I+   ALL L L   V   ++V+VL+  +FE  +   +  LVEFYAPWCGHCK LAPEY 
Sbjct: 6   IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63

Query: 215 KAATKLAEEES 247
           K      + +S
Sbjct: 64  KLGASFKKAKS 74



 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 2/55 (3%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKKTG 414
           +A +DA   + L E YGV G+PTLKFF   N +  DY GGR  DD +S++ +K+G
Sbjct: 196 IANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSG 250



 Score = 48.0 bits (109), Expect = 5e-06
 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 2/58 (3%)
 Frame = +1

Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 414
           S  +AKVD  +++ +   YGV GYPT+++F  GS  P  Y G R A+ +  ++ K+ G
Sbjct: 74  SVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131


>At2g47470.1 68415.m05925 thioredoxin family protein similar to
           protein disulfide isomerase [Dictyostelium discoideum]
           GI:2627440; contains Pfam profile: PF00085 Thioredoxin
          Length = 361

 Score = 69.3 bits (162), Expect = 2e-12
 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%)
 Frame = +2

Query: 92  ENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           +NV+VL+  NF E V+   + +LVEFYAPWCGHCKSLAP Y K AT   +EE  +
Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVV 195



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 32/71 (45%), Positives = 42/71 (59%)
 Frame = +2

Query: 35  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 214
           I+   ALL L L   V   ++V+VL+  +FE  +   +  LVEFYAPWCGHCK LAPEY 
Sbjct: 6   IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63

Query: 215 KAATKLAEEES 247
           K      + +S
Sbjct: 64  KLGASFKKAKS 74



 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 2/55 (3%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKKTG 414
           +A +DA   + L E YGV G+PTLKFF   N +  DY GGR  DD +S++ +K+G
Sbjct: 196 IANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSG 250



 Score = 48.0 bits (109), Expect = 5e-06
 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 2/58 (3%)
 Frame = +1

Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 414
           S  +AKVD  +++ +   YGV GYPT+++F  GS  P  Y G R A+ +  ++ K+ G
Sbjct: 74  SVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131


>At1g35620.1 68414.m04425 thioredoxin family protein similar to
           SP|Q43116 Protein disulfide isomerase precursor (PDI)
           (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile
           PF00085: Thioredoxin
          Length = 440

 Score = 65.7 bits (153), Expect = 2e-11
 Identities = 31/65 (47%), Positives = 42/65 (64%)
 Frame = +2

Query: 74  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           D+   +  VL L+ +NF++ I+T + I V+FYAPWCGHCK L PE   AA  LA+ + PI
Sbjct: 26  DQFTLDGTVLELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLNPELDAAAPILAKLKQPI 85

Query: 254 N*RKL 268
              KL
Sbjct: 86  VIAKL 90



 Score = 51.2 bits (117), Expect = 5e-07
 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 3/87 (3%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVT 435
           +AK++A +   LA    +  +PTL  + +G P++Y G R+AD ++ +LKK   P    + 
Sbjct: 87  IAKLNADKYSRLARKIEIDAFPTLMLYNHGVPMEYYGPRKADLLVRYLKKFVAPDVAVLE 146

Query: 436 SAEQAKELI-DANTV--IVFGFFSDQS 507
           S    KE + DA T   +  GF  ++S
Sbjct: 147 SDSTVKEFVEDAGTFFPVFIGFGLNES 173


>At3g16110.1 68416.m02035 thioredoxin family protein similar to
           protein disulfide isomerase GI:5902592 from [Volvox
           carteri f. nagariensis], GI:2708314 from Chlamydomonas
           reinhardtii; contains Pfam profile: PF00085 Thioredoxin
          Length = 534

 Score = 62.1 bits (144), Expect = 3e-10
 Identities = 24/83 (28%), Positives = 48/83 (57%)
 Frame = +1

Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAV 426
           S  +AK+D  +   +A    ++G+PTL  F NG+   Y+GG  +++I+ W++KKTG   +
Sbjct: 127 SVLMAKIDGERYSKVASQLEIKGFPTLLLFVNGTSQSYTGGFSSEEIVIWVQKKTGASTI 186

Query: 427 EVTSAEQAKELIDANTVIVFGFF 495
           ++ + ++A   +  +   + G F
Sbjct: 187 KLDTVDEASGFLKKHHTFILGLF 209



 Score = 44.4 bits (100), Expect = 6e-05
 Identities = 21/52 (40%), Positives = 30/52 (57%)
 Frame = +2

Query: 98  VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           V+ L+  N + +I   EY++V  YAPWC     L P +A+AAT L E  S +
Sbjct: 77  VVELNGDNTKRLIDGNEYVMVLGYAPWCARSAELMPRFAEAATDLKEIGSSV 128


>At1g04980.1 68414.m00497 thioredoxin family protein similar to
           SP|Q63081 Protein disulfide isomerase A6 precursor (EC
           5.3.4.1) {Rattus norvegicus}; contains Pfam profile
           PF00085: Thioredoxin
          Length = 443

 Score = 58.4 bits (135), Expect = 3e-09
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query: 107 LSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 232
           L+ +NF+ ++T ++ + +VEF+APWCGHCK LAPE+ KAA  L
Sbjct: 168 LNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKAANNL 210



 Score = 54.8 bits (126), Expect = 4e-08
 Identities = 23/46 (50%), Positives = 34/46 (73%), Gaps = 1/46 (2%)
 Frame = +2

Query: 98  VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 232
           VL L+ +NF++ V+ +   +LVEF+APWCGHC+SL P + K A+ L
Sbjct: 30  VLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVASTL 75



 Score = 47.6 bits (108), Expect = 6e-06
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKK 408
           +A +DA   + +++ YGVRG+PT+K F  G  PIDY G R A  I  +  K+
Sbjct: 81  VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQ 132


>At2g32920.1 68415.m04036 thioredoxin family protein similar to
           SP|Q15084 Protein disulfide isomerase A6 precursor (EC
           5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085:
           Thioredoxin
          Length = 440

 Score = 56.0 bits (129), Expect = 2e-08
 Identities = 24/43 (55%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query: 107 LSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 232
           L+ +NF+  VI + E  +VEF+APWCGHCK LAPE+ +AA  L
Sbjct: 167 LNASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEWKRAAKNL 209



 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 22/46 (47%), Positives = 33/46 (71%), Gaps = 1/46 (2%)
 Frame = +2

Query: 98  VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 232
           V+ L+ +NF++ V+ +   +LVEF+APWCGHCK+L P + K A  L
Sbjct: 32  VVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANIL 77



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWLKKK 408
           +A +DA   Q  A+ YG++G+PT+K F  G +PIDY G R A  I ++  K+
Sbjct: 83  VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQGARDAKSIANFAYKQ 134


>At4g27080.1 68417.m03893 thioredoxin family protein contains Pfam
           PF00085: Thioredoxin
          Length = 480

 Score = 48.0 bits (109), Expect = 5e-06
 Identities = 24/62 (38%), Positives = 33/62 (53%), Gaps = 2/62 (3%)
 Frame = +2

Query: 71  GDEVPTE--ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 244
           GDE   E  E+ + L+  NF+T       ++V FYAPWC  C  L P + KAA ++ E  
Sbjct: 132 GDETGEEIVEDSVPLTGRNFDTFTHQFPILVVNFYAPWCYWCNLLKPSWEKAAKQIKERY 191

Query: 245 SP 250
            P
Sbjct: 192 DP 193



 Score = 41.1 bits (92), Expect = 5e-04
 Identities = 17/33 (51%), Positives = 23/33 (69%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 354
           LAKVD TQE DL     ++GYP+++ FR GS +
Sbjct: 201 LAKVDCTQEGDLCRRNHIQGYPSIRIFRKGSDL 233


>At2g01270.1 68415.m00040 thioredoxin family protein low similarity
           to quiescin [Homo sapiens] GI:13257405; contains Pfam
           profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr
           family
          Length = 495

 Score = 41.9 bits (94), Expect = 3e-04
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 2/47 (4%)
 Frame = +2

Query: 89  EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 223
           ++  + L+  NF++V+  T  +Y +VEF+A WC  C++  P Y K A
Sbjct: 34  KDKAVELNTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEKVA 80


>At1g15020.2 68414.m01795 thioredoxin family protein low similarity
           to FAD-dependent sulfhydryl oxidase-2 [Rattus
           norvegicus] GI:12483919; contains Pfam profiles PF00085:
           Thioredoxin, PF04777: Erv1 / Alr family
          Length = 528

 Score = 41.1 bits (92), Expect = 5e-04
 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 2/47 (4%)
 Frame = +2

Query: 89  EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 223
           ++N + L+  NF++V   +  +Y ++EF+A WC  C++  P Y K A
Sbjct: 40  KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86


>At1g15020.1 68414.m01794 thioredoxin family protein low similarity
           to FAD-dependent sulfhydryl oxidase-2 [Rattus
           norvegicus] GI:12483919; contains Pfam profiles PF00085:
           Thioredoxin, PF04777: Erv1 / Alr family
          Length = 502

 Score = 41.1 bits (92), Expect = 5e-04
 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 2/47 (4%)
 Frame = +2

Query: 89  EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 223
           ++N + L+  NF++V   +  +Y ++EF+A WC  C++  P Y K A
Sbjct: 40  KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86


>At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2,
           chloroplast (APR2) (APSR) / adenosine 5'-phosphosulfate
           5'-adenylylsulfate (APS) sulfotransferase 2 /
           3'-phosphoadenosine-5'-phosphosulfate (PAPS) reductase
           homolog 43 (PRH-43) identical to SP|P92981
           5'-adenylylsulfate reductase 2, chloroplast precursor
           (EC 1.8.4.9) (Adenosine 5'-phosphosulfate
           5'-adenylylsulfate sulfotransferase 2) (APS
           sulfotransferase 2) (Thioredoxin independent APS
           reductase 2) (3'-phosphoadenosine-5'-phosphosulfate
           reductase homolog 43) (PAPS reductase homolog 43)
           (Prh-43) {Arabidopsis thaliana}; identical to cDNA PAPS
           reductase homolog (PRH43) GI:1710115
          Length = 454

 Score = 40.7 bits (91), Expect = 7e-04
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 3/56 (5%)
 Frame = +2

Query: 77  EVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 235
           E+    NV+ LSK   E ++      E  LV  YAPWC  C+++   Y + A KLA
Sbjct: 337 EIFESNNVVALSKGGVENLLKLENRKEAWLVVLYAPWCPFCQAMEASYIELAEKLA 392


>At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam
           profile: PF00085 Thioredoxin; identical to cDNA
           thioredoxin-like protein (hcf164 gene) GI;12049652
          Length = 261

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 2/70 (2%)
 Frame = +2

Query: 14  NIEMRVLIFTAIALLGLALGDEVPTEENV--LVLSKANFETVITTTEYILVEFYAPWCGH 187
           +I  RV   T IA L L +   +    ++  L  S   +E  ++  +  +VEFYA WC  
Sbjct: 93  DINRRVAAVTVIAALSLFVSTRLDFGISLKDLTASALPYEEALSNGKPTVVEFYADWCEV 152

Query: 188 CKSLAPEYAK 217
           C+ LAP+  K
Sbjct: 153 CRELAPDVYK 162


>At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879
           Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana};
           contains Pfam profile: PF00085 Thioredoxin
          Length = 148

 Score = 39.1 bits (87), Expect = 0.002
 Identities = 15/44 (34%), Positives = 25/44 (56%)
 Frame = +2

Query: 113 KANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 244
           K+    +  T + +++EF A WCG CK+L P+  + A K  + E
Sbjct: 49  KSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEELAAKYTDVE 92


>At3g20560.1 68416.m02603 thioredoxin family protein contains Pfam
           profile PF00085: Thioredoxin
          Length = 483

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 2/72 (2%)
 Frame = +2

Query: 41  TAIALLGLALGDEVPTE--ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 214
           + +AL  +  G+E   E  +  + L+ A+FE +      ++V F APWC     L P + 
Sbjct: 122 SGLALHNINHGEETKEEFPDGAIPLTSASFEALSHHFPILVVNFNAPWCYWSNRLKPSWE 181

Query: 215 KAATKLAEEESP 250
           KAA  + +   P
Sbjct: 182 KAANIIKQRYDP 193



 Score = 35.1 bits (77), Expect = 0.035
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 10/64 (15%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----------DYSGGRQADDIISWLKK 405
           L  VD T+E  L +   ++GYP+++ FR GS +           Y G R  D I+  ++ 
Sbjct: 201 LGNVDCTEEPALCKRNHIQGYPSIRIFRKGSDLREDHGHHEHESYYGDRDTDSIVKMVEG 260

Query: 406 KTGP 417
              P
Sbjct: 261 LVAP 264


>At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1)
           nearly identical to SP|O48737 Thioredoxin M-type 1,
           chloroplast precursor (TRX-M1) {Arabidopsis thaliana};
           similar to ESTs gb|T13714, gb|H76398, gb|N37762,
           gb|AA042639, gb|T21104, emb|Z30901
          Length = 179

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 1/51 (1%)
 Frame = +2

Query: 86  TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 235
           T   + V++ + +++ V+   E + V+F+APWCG CK + P   + A K A
Sbjct: 72  TATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYA 122



 Score = 27.1 bits (57), Expect = 9.2
 Identities = 13/48 (27%), Positives = 22/48 (45%)
 Frame = +1

Query: 250 YQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 393
           ++  K++  +       YGVR  PT+  F NG   D   G  + D ++
Sbjct: 125 FKFYKLNTDESPATPGQYGVRSIPTIMIFVNGEKKDTIIGAVSKDTLA 172


>At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879
           Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana};
           contains Pfam profile: PF00085 Thioredoxin
          Length = 129

 Score = 37.5 bits (83), Expect = 0.007
 Identities = 13/42 (30%), Positives = 28/42 (66%)
 Frame = +2

Query: 113 KANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 238
           K+ F+++  + + ++++F A WCG CK++ P   + A+K +E
Sbjct: 33  KSLFDSMKGSNKLLVIDFTAVWCGPCKAMEPRVREIASKYSE 74


>At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS
           reductase homolog (PRH19) identical to
           5'-adenylylsulfate reductase [Arabidopsis thaliana]
           GI:2738756; identical to cDNA PAPS reductase homolog
           (PRH19) GI:1710111
          Length = 465

 Score = 37.1 bits (82), Expect = 0.009
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 3/51 (5%)
 Frame = +2

Query: 92  ENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 235
           EN++ LS+   E ++      E  +V  YAPWC  C+++   Y + A KLA
Sbjct: 353 ENLVTLSRQGIENLMKLENRKEPWIVVLYAPWCPFCQAMEASYDELADKLA 403


>At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2)
           nearly identical to SP|Q9SEU8 Thioredoxin M-type 2,
           chloroplast precursor (TRX-M2) {Arabidopsis thaliana}
          Length = 186

 Score = 37.1 bits (82), Expect = 0.009
 Identities = 14/41 (34%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = +2

Query: 86  TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAP 205
           T  ++ V++ + +++ V+  T  ++V+F+APWCG CK + P
Sbjct: 78  TTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDP 118


>At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4)
           nearly identical to SP|Q9SEU6 Thioredoxin M-type 4,
           chloroplast precursor (TRX-M4) {Arabidopsis thaliana}
          Length = 193

 Score = 37.1 bits (82), Expect = 0.009
 Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 1/34 (2%)
 Frame = +2

Query: 107 LSKANFETVITTTEY-ILVEFYAPWCGHCKSLAP 205
           LS + ++T +  ++  +LVEF+APWCG C+ + P
Sbjct: 91  LSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHP 124



 Score = 28.3 bits (60), Expect = 4.0
 Identities = 10/36 (27%), Positives = 19/36 (52%)
 Frame = +1

Query: 250 YQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID 357
           ++  K++  +  + A  YG+R  PT+  F+ G   D
Sbjct: 137 FKFYKINTDESPNTANRYGIRSVPTVIIFKGGEKKD 172


>At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN)
           identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4)
           {Arabidopsis thaliana}
          Length = 119

 Score = 37.1 bits (82), Expect = 0.009
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 414
           KVD  + Q +A+ +GV   PT  F + G  +D   G   +D+ + + K TG
Sbjct: 65  KVDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKHTG 115



 Score = 28.7 bits (61), Expect = 3.0
 Identities = 10/30 (33%), Positives = 18/30 (60%)
 Frame = +2

Query: 140 TTEYILVEFYAPWCGHCKSLAPEYAKAATK 229
           + + I+++F A WC  C+ +AP +   A K
Sbjct: 27  SNKLIVIDFTASWCPPCRMIAPIFNDLAKK 56


>At1g50950.1 68414.m05728 thioredoxin-related contains weak hit to
           Pfam PF00085: Thioredoxin; contains 2 predicted
           transmembrane domains
          Length = 484

 Score = 36.3 bits (80), Expect = 0.015
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 10/64 (15%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----------DYSGGRQADDIISWLKK 405
           L  VD T+E  L +S  ++GYP+++ FR GS +           Y G R  D ++  +++
Sbjct: 202 LGSVDCTEEPTLCKSNHIQGYPSIRIFRRGSGLREDHGNHEHESYYGDRDTDSLVKMVEE 261

Query: 406 KTGP 417
              P
Sbjct: 262 LLKP 265



 Score = 35.9 bits (79), Expect = 0.020
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = +2

Query: 107 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESP 250
           L+ A FE      + ++V FYAPWC     L P + KA+    E  +P
Sbjct: 147 LTGAAFEKFTHHFQILVVNFYAPWCYWSNRLKPSWVKASQITRERYNP 194


>At5g61440.1 68418.m07709 thioredoxin family protein low similarity
           to thioredoxin [Callithrix jacchus] GI:13560979;
           contains Pfam profile: PF00085 Thioredoxin
          Length = 245

 Score = 35.9 bits (79), Expect = 0.020
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +2

Query: 77  EVPTEENVLVLSKANF--ETVITTTEYILV-EFYAPWCGHCKSLAPEYAKAA 223
           E  T  N+L +  AN   ++++   + ++V +FY+P CG CKSL P+  + A
Sbjct: 80  EKSTNHNMLEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQLA 131


>At4g04950.1 68417.m00719 thioredoxin family protein similar to
           PKCq-interacting protein PICOT from [Mus musculus]
           GI:6840949, [Rattus norvegicus] GI:6840951; contains
           Pfam profile PF00085: Thioredoxin
          Length = 488

 Score = 35.9 bits (79), Expect = 0.020
 Identities = 23/63 (36%), Positives = 33/63 (52%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 441
           +V+A +  +++E+Y V   P   FF++G  +D   G  AD   S L  K G  A   TSA
Sbjct: 57  RVEAEEHPEISEAYSVAAVPYFVFFKDGKTVDTLEG--ADP--SSLANKVGKVAGSSTSA 112

Query: 442 EQA 450
           E A
Sbjct: 113 EPA 115


>At1g34780.1 68414.m04329 protein disulfide isomerase-related
           contains weak similarity to Pfam:P08003 protein
           disulfide isomerase A4 precursor (Protein ERp-72, ERp72)
           [Mus musculus]
          Length = 310

 Score = 35.9 bits (79), Expect = 0.020
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +1

Query: 301 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQA 450
           YGV G+PTL    +     Y G R  D ++++    TG   ++ TS E++
Sbjct: 131 YGVHGFPTLLLLNSTMRARYRGTRMLDSLVAFYSDVTGIETLDKTSLERS 180


>At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / PAPS
           reductase homolog (PRH26) identical to
           5'-adenylylsulfate reductase [Arabidopsis thaliana]
           GI:2738760; identical to cDNA PAPS reductase homolog
           (PRH26) GI:1710113
          Length = 458

 Score = 35.5 bits (78), Expect = 0.026
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 3/61 (4%)
 Frame = +2

Query: 59  GLALGDEVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATK 229
           G A   ++   ENV+ LS+   E ++      E  +V  YAPWC  C+++   + + A K
Sbjct: 335 GTASVADIFNSENVVNLSRQGIENLMKLENRKEAWIVVLYAPWCPFCQAMEASFDELADK 394

Query: 230 L 232
           L
Sbjct: 395 L 395


>At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical
           to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis
           thaliana}
          Length = 114

 Score = 35.1 bits (77), Expect = 0.035
 Identities = 13/27 (48%), Positives = 19/27 (70%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATKL 232
           ++V+F A WCG C+ +AP +A  A KL
Sbjct: 31  VVVDFTASWCGPCRFIAPFFADLAKKL 57



 Score = 31.1 bits (67), Expect = 0.57
 Identities = 13/48 (27%), Positives = 25/48 (52%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 405
           KVD  + + +A  + ++  PT  F + G  +D   G + D++ S + K
Sbjct: 64  KVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAK 111


>At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam
           profile: PF00085 Thioredoxin
          Length = 273

 Score = 35.1 bits (77), Expect = 0.035
 Identities = 14/31 (45%), Positives = 21/31 (67%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 244
           ++V+F++P CG CK+L P+  K A K  E E
Sbjct: 116 VVVDFFSPSCGGCKALHPKICKIAEKNPEVE 146


>At1g50320.1 68414.m05641 thioredoxin x nearly identical to
           thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis
           thaliana]
          Length = 182

 Score = 35.1 bits (77), Expect = 0.035
 Identities = 13/26 (50%), Positives = 18/26 (69%)
 Frame = +2

Query: 128 TVITTTEYILVEFYAPWCGHCKSLAP 205
           TV+ + + +LVEF A WCG CK + P
Sbjct: 82  TVLESAQPVLVEFVATWCGPCKLIYP 107


>At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam
           profile PF00085: Thioredoxin
          Length = 236

 Score = 34.7 bits (76), Expect = 0.046
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229
           ++VEFY  WC  C++L P+  K A +
Sbjct: 126 VIVEFYGTWCASCRALFPKLCKTAVE 151


>At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam
           profile PF00085: Thioredoxin
          Length = 235

 Score = 34.7 bits (76), Expect = 0.046
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229
           ++VEFY  WC  C++L P+  K A +
Sbjct: 126 VIVEFYGTWCASCRALFPKLCKTAVE 151


>At4g26160.1 68417.m03765 thioredoxin family protein low similarity
           to thioredoxin [Ictalurus punctatus] GI:9837585;
           contains Pfam profile: PF00085 Thioredoxin
          Length = 221

 Score = 34.7 bits (76), Expect = 0.046
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAA 223
           ++V+FY  WCG C+++ P+  K A
Sbjct: 116 VIVDFYGTWCGSCRAMFPKLCKTA 139



 Score = 27.9 bits (59), Expect = 5.3
 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 2/36 (5%)
 Frame = +1

Query: 394 WLKKKTGPPAVEVTSAEQ-AKELIDA-NTVIVFGFF 495
           W ++K GP  +++TSAEQ    L DA + +++  F+
Sbjct: 86  WWERKAGPNMIDITSAEQFLNALKDAGDRLVIVDFY 121


>At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450
           Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum
           sativum}; contains Pfam profile: PF00085 Thioredoxin
          Length = 185

 Score = 33.9 bits (74), Expect = 0.080
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229
           ++++ Y  WCG CK +AP+Y + + K
Sbjct: 100 VVLDMYTQWCGPCKVIAPKYKELSEK 125



 Score = 27.1 bits (57), Expect = 9.2
 Identities = 12/45 (26%), Positives = 25/45 (55%), Gaps = 1/45 (2%)
 Frame = +1

Query: 262 KVDATQE-QDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 393
           K+D  Q+ + LA+  G+R  PT K  ++   +    G + +D+++
Sbjct: 133 KLDCNQDNKPLAKELGIRVVPTFKILKDNKVVKEVTGAKYEDLLA 177


>At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450
           Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum
           sativum}; contains Pfam profile: PF00085 Thioredoxin
          Length = 178

 Score = 33.1 bits (72), Expect = 0.14
 Identities = 10/26 (38%), Positives = 17/26 (65%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229
           ++++ Y  WCG CK +AP+Y   + K
Sbjct: 90  VVLDMYTQWCGPCKVIAPKYKALSEK 115


>At1g07700.3 68414.m00829 thioredoxin family protein low similarity
           to thioredoxin [Gallus gallus] GI:212766; contains Pfam
           profile: PF00085 Thioredoxin
          Length = 217

 Score = 33.1 bits (72), Expect = 0.14
 Identities = 11/38 (28%), Positives = 22/38 (57%)
 Frame = +2

Query: 140 TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           T   ++V+FY   CG CK +   ++K   +  ++E+P+
Sbjct: 119 TNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPV 156


>At1g07700.2 68414.m00827 thioredoxin family protein low similarity
           to thioredoxin [Gallus gallus] GI:212766; contains Pfam
           profile: PF00085 Thioredoxin
          Length = 171

 Score = 33.1 bits (72), Expect = 0.14
 Identities = 11/38 (28%), Positives = 22/38 (57%)
 Frame = +2

Query: 140 TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           T   ++V+FY   CG CK +   ++K   +  ++E+P+
Sbjct: 106 TNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPV 143


>At1g07700.1 68414.m00828 thioredoxin family protein low similarity
           to thioredoxin [Gallus gallus] GI:212766; contains Pfam
           profile: PF00085 Thioredoxin
          Length = 204

 Score = 33.1 bits (72), Expect = 0.14
 Identities = 11/38 (28%), Positives = 22/38 (57%)
 Frame = +2

Query: 140 TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           T   ++V+FY   CG CK +   ++K   +  ++E+P+
Sbjct: 106 TNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPV 143


>At1g76760.1 68414.m08933 thioredoxin family protein similar to
           thioredoxin CH2, M-type, chloroplast precursor GB:P23400
           SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam
           profile: PF00085 Thioredoxin
          Length = 172

 Score = 32.7 bits (71), Expect = 0.19
 Identities = 11/30 (36%), Positives = 21/30 (70%), Gaps = 1/30 (3%)
 Frame = +2

Query: 119 NFETVITTTEY-ILVEFYAPWCGHCKSLAP 205
           +FE ++  ++  +LV++YA WCG C+ + P
Sbjct: 72  SFEDLLVNSDKPVLVDYYATWCGPCQFMVP 101



 Score = 32.3 bits (70), Expect = 0.24
 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDII 390
           Q+ K+D  +   +A  Y +   PT   F++G P D + G   A  +I
Sbjct: 115 QVVKIDTEKYPSIANKYKIEALPTFILFKDGEPCDRFEGALTAKQLI 161


>At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL)
           identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5)
           {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA
           for thioredoxin GI:992965
          Length = 118

 Score = 32.7 bits (71), Expect = 0.19
 Identities = 17/51 (33%), Positives = 25/51 (49%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 414
           K+D  + Q +A+ + V   PT  F + G+ ID   G   D+I   L K  G
Sbjct: 63  KIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKHGG 113



 Score = 31.5 bits (68), Expect = 0.43
 Identities = 11/26 (42%), Positives = 18/26 (69%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229
           I+++F A WC  C+ +AP +A+ A K
Sbjct: 30  IVIDFTASWCPPCRFIAPVFAEMAKK 55


>At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam
           profile: PF00085 Thioredoxin; similar to thioredoxin
           GI:142153 from [Synechococcus PCC6301]
          Length = 167

 Score = 32.3 bits (70), Expect = 0.24
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAP 205
           +LV+FYA WCG C+ + P
Sbjct: 79  VLVDFYATWCGPCQLMVP 96


>At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam
           profile: PF00085 Thioredoxin
          Length = 160

 Score = 31.1 bits (67), Expect = 0.57
 Identities = 20/60 (33%), Positives = 31/60 (51%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 441
           +V+A +  +++E+Y V   P   FF++G  +D   G  AD   S L  K G  A  +T A
Sbjct: 57  RVEAEEHPEISEAYSVALVPYFVFFKDGKTVDTLEG--ADP--SSLANKVGKVAGSITPA 112


>At3g19780.1 68416.m02504 expressed protein
          Length = 1014

 Score = 31.1 bits (67), Expect = 0.57
 Identities = 13/45 (28%), Positives = 23/45 (51%)
 Frame = +2

Query: 104 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 238
           +L++ NF + I    ++L+    PWCG  +SL  E  +   +  E
Sbjct: 29  ILTEQNFSSQIRLHPHVLLFVTTPWCGESRSLKYEITQMVQRREE 73


>At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to
           tetratricoredoxin [Arabidopsis thaliana] GI:18041544;
           similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem
           sap 13 kDa protein-1) {Oryza sativa}; contains Pfam
           profile: PF00085 Thioredoxin
          Length = 380

 Score = 31.1 bits (67), Expect = 0.57
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229
           +++ F A WCG C+ ++P Y+  AT+
Sbjct: 295 LILYFTATWCGPCRYMSPLYSNLATQ 320



 Score = 30.3 bits (65), Expect = 0.99
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPID 357
           KVD  +  D+A S+ +   PT  F R+G  +D
Sbjct: 328 KVDIDKANDVAASWNISSVPTFCFIRDGKEVD 359


>At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3)
           identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast
           precursor (TRX-M3) {Arabidopsis thaliana}
          Length = 173

 Score = 31.1 bits (67), Expect = 0.57
 Identities = 10/23 (43%), Positives = 16/23 (69%)
 Frame = +2

Query: 125 ETVITTTEYILVEFYAPWCGHCK 193
           ++V+ +   +LVEFY  WCG C+
Sbjct: 78  DSVLKSETPVLVEFYTSWCGPCR 100


>At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1)
           identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3)
           {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA
           for thioredoxin GI:992961
          Length = 118

 Score = 30.7 bits (66), Expect = 0.75
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229
           I+++F A WC  C+ +AP +A  A K
Sbjct: 30  IVIDFTATWCPPCRFIAPVFADLAKK 55



 Score = 28.7 bits (61), Expect = 3.0
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 405
           KVD  +   +AE + V+  PT  F + G   +   G   ++II+ L+K
Sbjct: 63  KVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEK 110


>At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2)
           identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2)
           {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA
           for thioredoxin GI:992963
          Length = 133

 Score = 30.7 bits (66), Expect = 0.75
 Identities = 11/37 (29%), Positives = 20/37 (54%)
 Frame = +2

Query: 119 NFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 229
           +F  +  + + ++V+F A WCG C+ + P     A K
Sbjct: 39  HFNEIKESNKLLVVDFSASWCGPCRMIEPAIHAMADK 75


>At4g08930.1 68417.m01470 thioredoxin-related contains weak
           similarity to Swiss-Prot:Q39239 thioredoxin H-type 4
           (TRX-H-4). [Mouse-ear cress]
          Length = 295

 Score = 30.7 bits (66), Expect = 0.75
 Identities = 12/38 (31%), Positives = 20/38 (52%)
 Frame = +1

Query: 301 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 414
           YGV G+PT+    +   + Y G R  D ++++    TG
Sbjct: 124 YGVHGFPTIILMNSTMLVVYRGSRTLDSLVAFYTDVTG 161


>At3g63440.1 68416.m07143 FAD-binding domain-containing protein /
           cytokinin oxidase family protein similar to cytokinin
           oxidase, Zea mays, EMBL:ZMY18377 [gi:3882018]
           [gi:3441978]
          Length = 504

 Score = 30.3 bits (65), Expect = 0.99
 Identities = 17/54 (31%), Positives = 27/54 (50%)
 Frame = -2

Query: 288 ILFLSCVNFR*LIGDSSSASFVAALAYSGARDLQWPHHGA*NSTKMYSVVVITV 127
           IL LSC+ F+     SSS S + AL   G  + +  HH + +    Y ++ + V
Sbjct: 9   ILLLSCIAFKLACCFSSSISSLKALPLVGHLEFEHVHHASKDFGNRYQLIPLAV 62


>At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam
           profile: PF00085 Thioredoxin
          Length = 183

 Score = 30.3 bits (65), Expect = 0.99
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229
           ++V+FYA WCG C  +A E    A +
Sbjct: 97  LIVDFYATWCGPCILMAQELEMLAVE 122



 Score = 27.1 bits (57), Expect = 9.2
 Identities = 14/32 (43%), Positives = 17/32 (53%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSP 351
           + KVD   E + A    VRG PTL FF +  P
Sbjct: 129 IVKVDTDDEYEFARDMQVRGLPTL-FFISPDP 159


>At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam
           profile: PF00085 Thioredoxin; similar to ESTs gb|T46281,
           gb|R83933, gb|N65879, emb|F14466, gb|N96726,
           gb|AA042340, and emb|Z18150
          Length = 275

 Score = 30.3 bits (65), Expect = 0.99
 Identities = 10/24 (41%), Positives = 18/24 (75%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAA 223
           ++V+F++P CG CK+L P+  + A
Sbjct: 120 VVVDFFSPGCGGCKALHPKICQFA 143


>At3g08710.1 68416.m01012 thioredoxin family protein similar to
           thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis
           thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090
           {Nicotiana tabacum}; contains Pfam profile: PF00085
           Thioredoxin
          Length = 140

 Score = 29.5 bits (63), Expect = 1.7
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229
           ++  F A WCG CK +AP + + + K
Sbjct: 48  VVANFSATWCGPCKIVAPFFIELSEK 73


>At1g52990.1 68414.m05997 thioredoxin family protein similar to
           SP|P48384 Thioredoxin M-type, chloroplast precursor
           (TRX-M) {Pisum sativum}; contains Pfam profile PF00085:
           Thioredoxin
          Length = 313

 Score = 29.5 bits (63), Expect = 1.7
 Identities = 11/33 (33%), Positives = 18/33 (54%)
 Frame = +2

Query: 143 TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 241
           T +++V F A WCG C+ + P   K  ++   E
Sbjct: 227 TPHVMVMFTARWCGPCRDMIPILNKMDSEYKNE 259


>At1g07960.3 68414.m00867 thioredoxin family protein low similarity
           to protein disulfide isomerase 4 [Giardia intestinalis]
           GI:13489047; contains Pfam profile PF00085: Thioredoxin
          Length = 146

 Score = 28.7 bits (61), Expect = 3.0
 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%)
 Frame = +2

Query: 98  VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 199
           V+ L+   F   I   +    V+F  PWC HCK L
Sbjct: 27  VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61



 Score = 28.7 bits (61), Expect = 3.0
 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVE 429
           ++ +VD    + +     +  YPT   F NG  +  Y G R  + + +++ ++T   A E
Sbjct: 79  EVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-EKAAE 137

Query: 430 VTSAEQAKEL 459
               E  KEL
Sbjct: 138 KAQLED-KEL 146


>At1g07960.2 68414.m00866 thioredoxin family protein low similarity
           to protein disulfide isomerase 4 [Giardia intestinalis]
           GI:13489047; contains Pfam profile PF00085: Thioredoxin
          Length = 146

 Score = 28.7 bits (61), Expect = 3.0
 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%)
 Frame = +2

Query: 98  VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 199
           V+ L+   F   I   +    V+F  PWC HCK L
Sbjct: 27  VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61



 Score = 28.7 bits (61), Expect = 3.0
 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVE 429
           ++ +VD    + +     +  YPT   F NG  +  Y G R  + + +++ ++T   A E
Sbjct: 79  EVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-EKAAE 137

Query: 430 VTSAEQAKEL 459
               E  KEL
Sbjct: 138 KAQLED-KEL 146


>At1g07960.1 68414.m00865 thioredoxin family protein low similarity
           to protein disulfide isomerase 4 [Giardia intestinalis]
           GI:13489047; contains Pfam profile PF00085: Thioredoxin
          Length = 146

 Score = 28.7 bits (61), Expect = 3.0
 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%)
 Frame = +2

Query: 98  VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 199
           V+ L+   F   I   +    V+F  PWC HCK L
Sbjct: 27  VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61



 Score = 28.7 bits (61), Expect = 3.0
 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVE 429
           ++ +VD    + +     +  YPT   F NG  +  Y G R  + + +++ ++T   A E
Sbjct: 79  EVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-EKAAE 137

Query: 430 VTSAEQAKEL 459
               E  KEL
Sbjct: 138 KAQLED-KEL 146


>At1g11530.1 68414.m01324 thioredoxin family protein similar to
           thioredoxin H-type from Arabidopsis thaliana SP|P29448,
           Nicotiana tabacum SP|Q07090; contains Pfam profile:
           PF00085 Thioredoxin
          Length = 118

 Score = 28.3 bits (60), Expect = 4.0
 Identities = 12/41 (29%), Positives = 22/41 (53%)
 Frame = +1

Query: 265 VDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 387
           VD  + +++A    V+  PT  F ++G+ +D   G   D+I
Sbjct: 61  VDVDEVKEVASQLEVKAMPTFLFLKDGNAMDKLVGANPDEI 101


>At4g16140.1 68417.m02445 proline-rich family protein contains
           proline-rich extensin domains, INTERPRO:IPR002965
          Length = 164

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 11/34 (32%), Positives = 19/34 (55%)
 Frame = -3

Query: 464 SISSLACSAEVTSTAGGPVFFFSQLMMSSA*RPP 363
           S ++ AC    +S+ GGP +++     S + RPP
Sbjct: 60  SPTTTACPPPPSSSGGGPYYYYPPASQSGSYRPP 93


>At2g27350.3 68415.m03293 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 506

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 24/108 (22%), Positives = 46/108 (42%), Gaps = 4/108 (3%)
 Frame = +1

Query: 133 NYNHGVHFS*ILCSMVRPLQISGTGIRQGSNKAG*RRISYQLAK--VDATQEQDLAESYG 306
           +Y+HG H++    S+V P +++  G   G +    R +  +  K  + A QE  +  +  
Sbjct: 326 SYHHGNHYN----SLVDPHRLT-VGAGLGFSSLSGRHVDKEQVKAAIKAQQEHQIDNALL 380

Query: 307 VRG--YPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAE 444
             G  Y  L+              +A+ ++ W K + GP     ++AE
Sbjct: 381 AEGRFYSDLELTEKEIERSVMEASRAEYLMEWSKPRIGPKESSTSNAE 428


>At2g27350.2 68415.m03292 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 505

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 24/108 (22%), Positives = 46/108 (42%), Gaps = 4/108 (3%)
 Frame = +1

Query: 133 NYNHGVHFS*ILCSMVRPLQISGTGIRQGSNKAG*RRISYQLAK--VDATQEQDLAESYG 306
           +Y+HG H++    S+V P +++  G   G +    R +  +  K  + A QE  +  +  
Sbjct: 326 SYHHGNHYN----SLVDPHRLT-VGAGLGFSSLSGRHVDKEQVKAAIKAQQEHQIDNALL 380

Query: 307 VRG--YPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAE 444
             G  Y  L+              +A+ ++ W K + GP     ++AE
Sbjct: 381 AEGRFYSDLELTEKEIERSVMEASRAEYLMEWSKPRIGPKESSTSNAE 428


>At2g27350.1 68415.m03291 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 505

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 24/108 (22%), Positives = 46/108 (42%), Gaps = 4/108 (3%)
 Frame = +1

Query: 133 NYNHGVHFS*ILCSMVRPLQISGTGIRQGSNKAG*RRISYQLAK--VDATQEQDLAESYG 306
           +Y+HG H++    S+V P +++  G   G +    R +  +  K  + A QE  +  +  
Sbjct: 326 SYHHGNHYN----SLVDPHRLT-VGAGLGFSSLSGRHVDKEQVKAAIKAQQEHQIDNALL 380

Query: 307 VRG--YPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAE 444
             G  Y  L+              +A+ ++ W K + GP     ++AE
Sbjct: 381 AEGRFYSDLELTEKEIERSVMEASRAEYLMEWSKPRIGPKESSTSNAE 428


>At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing
           protein contains Pfam profile PF00515 TPR Domain
          Length = 691

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 10/30 (33%), Positives = 17/30 (56%)
 Frame = +1

Query: 265 VDATQEQDLAESYGVRGYPTLKFFRNGSPI 354
           VD  +   LA++  +R  PT K ++NG  +
Sbjct: 642 VDVEESMALAKAESIRKVPTFKMYKNGDKV 671


>At2g29800.1 68415.m03620 kelch repeat-containing F-box family
           protein similar to SKP1 interacting partner 6
           [Arabidopsis thaliana] GI:10716957; contains Pfam
           profiles PF01344: Kelch motif, PF00646: F-box domain
          Length = 414

 Score = 27.1 bits (57), Expect = 9.2
 Identities = 13/32 (40%), Positives = 20/32 (62%)
 Frame = +3

Query: 486 WFLFGPELARAKTFLSTAQVVDDQVFAIVSDE 581
           W  +GPE A+   +  ++ VVDD ++AIV  E
Sbjct: 282 WETWGPESAQRSYWHLSSCVVDDLLYAIVPRE 313


>At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam
           profiles PF00085: Thioredoxin, PF00515: TPR Domain;
           similar to tetratricopeptide repeat protein 2
           (GI:7248701) [Drosophila melanogaster]; similar to DnaJ
           homolog subfamily C member 7 (Tetratricopeptide repeat
           protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615)
           [Homo sapiens]
          Length = 699

 Score = 27.1 bits (57), Expect = 9.2
 Identities = 12/36 (33%), Positives = 19/36 (52%)
 Frame = +1

Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 354
           S    KVD  +   +  +  VR  PT+K ++NGS +
Sbjct: 644 SIHFLKVDIDKCPSIGNAENVRVVPTVKIYKNGSRV 679


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,074,559
Number of Sequences: 28952
Number of extensions: 239247
Number of successful extensions: 802
Number of sequences better than 10.0: 69
Number of HSP's better than 10.0 without gapping: 723
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 794
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1151426952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -