SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30099.Seq
         (730 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha ...   181   5e-46
At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha ...   181   5e-46
At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha ...   181   5e-46
At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha ...   181   5e-46
At1g18070.1 68414.m02236 EF-1-alpha-related GTP-binding protein,...   114   6e-26
At5g10630.1 68418.m01231 elongation factor 1-alpha, putative / E...    93   2e-19
At4g02930.1 68417.m00399 elongation factor Tu, putative / EF-Tu,...    69   4e-12
At4g20360.1 68417.m02971 elongation factor Tu / EF-Tu (TUFA) ide...    66   2e-11
At4g18330.2 68417.m02719 eukaryotic translation initiation facto...    38   0.005
At4g18330.1 68417.m02718 eukaryotic translation initiation facto...    38   0.005
At1g04170.1 68414.m00407 eukaryotic translation initiation facto...    38   0.007
At2g18720.1 68415.m02180 eukaryotic translation initiation facto...    38   0.009
At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-...    35   0.048
At1g06220.2 68414.m00656 elongation factor Tu family protein sim...    33   0.15 
At1g06220.1 68414.m00655 elongation factor Tu family protein sim...    33   0.15 
At4g11160.1 68417.m01808 translation initiation factor IF-2, mit...    33   0.26 
At3g22980.1 68416.m02898 elongation factor Tu family protein sim...    33   0.26 
At1g62750.1 68414.m07082 elongation factor Tu family protein sim...    33   0.26 
At2g45030.1 68415.m05606 mitochondrial elongation factor, putati...    32   0.45 
At1g45332.1 68414.m05195 mitochondrial elongation factor, putati...    32   0.45 
At5g08650.1 68418.m01029 GTP-binding protein LepA, putative            31   1.0  
At3g01360.1 68416.m00057 expressed protein contains Pfam profile...    30   1.4  
At1g76720.1 68414.m08929 eukaryotic translation initiation facto...    30   1.4  
At1g21160.1 68414.m02646 eukaryotic translation initiation facto...    30   1.4  
At1g76825.1 68414.m08940 eukaryotic translation initiation facto...    30   1.8  
At1g76810.1 68414.m08938 eukaryotic translation initiation facto...    30   1.8  
At1g56070.1 68414.m06438 elongation factor 2, putative / EF-2, p...    29   2.4  
At5g60040.1 68418.m07529 DNA-directed RNA polymerase, putative s...    29   4.2  
At2g28000.1 68415.m03393 RuBisCO subunit binding-protein alpha s...    29   4.2  
At5g13650.2 68418.m01585 elongation factor family protein contai...    28   5.5  
At5g13650.1 68418.m01584 elongation factor family protein contai...    28   5.5  
At3g08870.1 68416.m01031 lectin protein kinase, putative similar...    28   5.5  
At1g20160.1 68414.m02521 subtilase family protein similar to sub...    28   5.5  
At1g17220.1 68414.m02098 translation initiation factor IF-2, chl...    28   5.5  

>At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha
           identical to SWISS-PROT:P13905 elongation factor 1-alpha
           (EF-1-alpha) [Arabidopsis thaliana]
          Length = 449

 Score =  181 bits (440), Expect = 5e-46
 Identities = 85/125 (68%), Positives = 99/125 (79%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHAL
Sbjct: 79  KFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQ+I   NKMD+T P Y      +  ++     KK+GYNP  + FVPISG+ G
Sbjct: 139 LAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEG 198

Query: 617 DNMLE 631
           DNM+E
Sbjct: 199 DNMIE 203



 Score =  130 bits (313), Expect = 1e-30
 Identities = 61/68 (89%), Positives = 62/68 (91%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score =  181 bits (440), Expect = 5e-46
 Identities = 85/125 (68%), Positives = 99/125 (79%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHAL
Sbjct: 79  KFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQ+I   NKMD+T P Y      +  ++     KK+GYNP  + FVPISG+ G
Sbjct: 139 LAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEG 198

Query: 617 DNMLE 631
           DNM+E
Sbjct: 199 DNMIE 203



 Score =  130 bits (313), Expect = 1e-30
 Identities = 61/68 (89%), Positives = 62/68 (91%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score =  181 bits (440), Expect = 5e-46
 Identities = 85/125 (68%), Positives = 99/125 (79%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHAL
Sbjct: 79  KFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQ+I   NKMD+T P Y      +  ++     KK+GYNP  + FVPISG+ G
Sbjct: 139 LAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEG 198

Query: 617 DNMLE 631
           DNM+E
Sbjct: 199 DNMIE 203



 Score =  130 bits (313), Expect = 1e-30
 Identities = 61/68 (89%), Positives = 62/68 (91%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score =  181 bits (440), Expect = 5e-46
 Identities = 85/125 (68%), Positives = 99/125 (79%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHAL
Sbjct: 79  KFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQ+I   NKMD+T P Y      +  ++     KK+GYNP  + FVPISG+ G
Sbjct: 139 LAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEG 198

Query: 617 DNMLE 631
           DNM+E
Sbjct: 199 DNMIE 203



 Score =  130 bits (313), Expect = 1e-30
 Identities = 61/68 (89%), Positives = 62/68 (91%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>At1g18070.1 68414.m02236 EF-1-alpha-related GTP-binding protein,
           putative similar to EF-1-alpha-related GTP-binding
           protein gi|1009232|gb|AAA79032
          Length = 532

 Score =  114 bits (274), Expect = 6e-26
 Identities = 60/123 (48%), Positives = 74/123 (60%), Gaps = 1/123 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET     TI+DAPGH+ ++ NMI+G SQAD  VL+++A  GEFE G  + GQTREH  L
Sbjct: 174 FETESTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGYERGGQTREHVQL 233

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGWHG 616
           A TLGV +LIV VNKMD     +      +  +K     K  GYN    V F+PISG  G
Sbjct: 234 AKTLGVSKLIVVVNKMDDPTVNWSKERYDEIEQKMVPFLKASGYNTKKDVVFLPISGLMG 293

Query: 617 DNM 625
            NM
Sbjct: 294 KNM 296



 Score = 68.1 bits (159), Expect = 6e-12
 Identities = 28/64 (43%), Positives = 46/64 (71%)
 Frame = +1

Query: 34  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 213
           +K H+N+V IGHVD+GKST  G +++  G +D R I+K+EKEA++  + S+  A+++D  
Sbjct: 98  KKRHLNVVFIGHVDAGKSTIGGQILFLSGQVDDRQIQKYEKEAKDKSRESWYMAYIMDTN 157

Query: 214 KAER 225
           + ER
Sbjct: 158 EEER 161


>At5g10630.1 68418.m01231 elongation factor 1-alpha, putative /
           EF-1-alpha, putative contains similarity to
           SWISS-PROT:Q9YAV0 elongation factor 1-alpha (EF-1-alpha)
           [Aeropyrum pernix]
          Length = 667

 Score = 93.1 bits (221), Expect = 2e-19
 Identities = 45/124 (36%), Positives = 73/124 (58%), Gaps = 1/124 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK-NGQTREHAL 436
           F + +++V ++D+PGH+DF+ NMI G +QAD A+L++ A  G FEAG     GQTREHA 
Sbjct: 312 FNSKRHHVVLLDSPGHKDFVPNMIAGATQADAAILVIDASVGAFEAGFDNLKGQTREHAR 371

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           +    GV+Q+IV +NKMD         DL K  +      +   +  +++ ++P+S    
Sbjct: 372 VLRGFGVEQVIVAINKMDIVGYSKERFDLIK--QHVGSFLQSCRFKDSSLTWIPLSAMEN 429

Query: 617 DNML 628
            N++
Sbjct: 430 QNLV 433



 Score = 77.4 bits (182), Expect = 9e-15
 Identities = 32/63 (50%), Positives = 46/63 (73%)
 Frame = +1

Query: 40  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 219
           + +N+ ++GHVDSGKST +G L++  G I ++ + K+EKEA+  GKGSF YAW LD+   
Sbjct: 238 SQLNLAIVGHVDSGKSTLSGRLLHLLGRISQKQMHKYEKEAKLQGKGSFAYAWALDESAE 297

Query: 220 ERE 228
           ERE
Sbjct: 298 ERE 300


>At4g02930.1 68417.m00399 elongation factor Tu, putative / EF-Tu,
           putative similar to mitochondrial elongation factor Tu
           [Arabidopsis thaliana] gi|1149571|emb|CAA61511
          Length = 454

 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 39/122 (31%), Positives = 63/122 (51%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ET+K +   +D PGH D++KNMITG +Q D  +L+V+   G          QT+EH L
Sbjct: 124 EYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSGPDGPMP-------QTKEHIL 176

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA  +GV  L+  +NK+D  + P +   +    R+    +K  G +   +    +S   G
Sbjct: 177 LARQVGVPSLVCFLNKVDVVDDPELLELVEMELRELLSFYKFPGDDIPIIRGSALSALQG 236

Query: 617 DN 622
            N
Sbjct: 237 TN 238



 Score = 32.7 bits (71), Expect = 0.26
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTT 96
           + K H+N+  IGHVD GK+T T
Sbjct: 63  RNKPHVNVGTIGHVDHGKTTLT 84


>At4g20360.1 68417.m02971 elongation factor Tu / EF-Tu (TUFA)
           identical to SWISS-PROT:P17745 elongation factor Tu,
           chloroplast precursor (EF-Tu) [Arabidopsis thaliana]
          Length = 476

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 32/81 (39%), Positives = 48/81 (59%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ET   +   +D PGH D++KNMITG +Q D A+L+V+   G          QT+EH L
Sbjct: 136 EYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGADGPMP-------QTKEHIL 188

Query: 437 LAFTLGVKQLIVGVNKMDSTE 499
           LA  +GV  ++V +NK D  +
Sbjct: 189 LAKQVGVPDMVVFLNKEDQVD 209



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +1

Query: 22  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK 156
           K  ++K H+NI  IGHVD GK+T T  L      I     +K+++
Sbjct: 72  KFERKKPHVNIGTIGHVDHGKTTLTAALTMALASIGSSVAKKYDE 116


>At4g18330.2 68417.m02719 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative similar to SP|Q09130 Eukaryotic translation
           initiation factor 2 gamma subunit (eIF-2- gamma)
           {Schizosaccharomyces pombe}; contains Pfam profile
           PF00009: Elongation factor Tu GTP binding domain;
           isoform predicted to contain a TG non-consensus acceptor
           splice site.
          Length = 471

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 22/75 (29%), Positives = 37/75 (49%)
 Frame = +2

Query: 266 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAF 445
           T + +V+ +D PGH   +  M+ G +  D A+L++AA             QT EH     
Sbjct: 124 TLRRHVSCVDCPGHDILMATMLNGAAIVDGALLLIAANES------CPQPQTAEHLASVD 177

Query: 446 TLGVKQLIVGVNKMD 490
            + +K +I+  NK+D
Sbjct: 178 MMRLKHIIILQNKID 192


>At4g18330.1 68417.m02718 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative similar to SP|Q09130 Eukaryotic translation
           initiation factor 2 gamma subunit (eIF-2- gamma)
           {Schizosaccharomyces pombe}; contains Pfam profile
           PF00009: Elongation factor Tu GTP binding domain;
           isoform predicted to contain a TG non-consensus acceptor
           splice site.
          Length = 284

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 22/75 (29%), Positives = 37/75 (49%)
 Frame = +2

Query: 266 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAF 445
           T + +V+ +D PGH   +  M+ G +  D A+L++AA             QT EH     
Sbjct: 124 TLRRHVSCVDCPGHDILMATMLNGAAIVDGALLLIAANES------CPQPQTAEHLASVD 177

Query: 446 TLGVKQLIVGVNKMD 490
            + +K +I+  NK+D
Sbjct: 178 MMRLKHIIILQNKID 192


>At1g04170.1 68414.m00407 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative similar to gb|U37354 from S. pombe. ESTs
           gb|T41979, gb|N37284 and gb|N37529 come from this gene
          Length = 465

 Score = 37.9 bits (84), Expect = 0.007
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 4/81 (4%)
 Frame = +2

Query: 260 FETSKY----YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           FE SK     +V+ +D PGH   +  M+ G +  D A+L++AA             QT E
Sbjct: 112 FENSKMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANE------TCPQPQTSE 165

Query: 428 HALLAFTLGVKQLIVGVNKMD 490
           H      + +K +I+  NK+D
Sbjct: 166 HLAAVEIMQLKHIIILQNKID 186


>At2g18720.1 68415.m02180 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative 
          Length = 465

 Score = 37.5 bits (83), Expect = 0.009
 Identities = 22/71 (30%), Positives = 35/71 (49%)
 Frame = +2

Query: 278 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 457
           +V+ +D PGH   +  M+ G +  D A+LI+AA             QT EH      + +
Sbjct: 120 HVSFVDCPGHDILMATMLNGAAIMDGALLIIAANE------TCPQPQTAEHLASVDMMHL 173

Query: 458 KQLIVGVNKMD 490
           K +I+  NK+D
Sbjct: 174 KDIIIIQNKID 184


>At5g39900.1 68418.m04839 GTP-binding protein LepA, putative
           GTP-binding protein GUF1 - Saccharomyces cerevisiae,
           PIR:S50374
          Length = 661

 Score = 35.1 bits (77), Expect = 0.048
 Identities = 28/93 (30%), Positives = 42/93 (45%)
 Frame = +2

Query: 263 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 442
           E S Y + +ID PGH DF   +    S    A+L+V A  G          QT  +  LA
Sbjct: 131 EASGYLLNLIDTPGHVDFSYEVSRSLSACQGALLVVDAAQG-------VQAQTVANFYLA 183

Query: 443 FTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRK 541
           F   +  ++  +NK+D    P   P+  K++ K
Sbjct: 184 FEANL-TIVPVINKIDQ---PTADPERVKAQLK 212



 Score = 27.9 bits (59), Expect = 7.3
 Identities = 16/40 (40%), Positives = 19/40 (47%)
 Frame = +1

Query: 13  D*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDK 132
           D  K   EK   N  +I H+D GKST    L+   G I K
Sbjct: 57  DLTKFPSEKIR-NFSIIAHIDHGKSTLADRLMELTGTIKK 95


>At1g06220.2 68414.m00656 elongation factor Tu family protein
           similar to Cryptosporidium parvum elongation factor-2
           GB:U21667 GI:706974 from [Cryptosporidium parvum]
          Length = 987

 Score = 33.5 bits (73), Expect = 0.15
 Identities = 17/40 (42%), Positives = 20/40 (50%)
 Frame = +2

Query: 266 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           +  Y   I+D PGH +F   M      AD AVLIV A  G
Sbjct: 206 SKSYLCNIMDTPGHVNFSDEMTASLRLADGAVLIVDAAEG 245


>At1g06220.1 68414.m00655 elongation factor Tu family protein
           similar to Cryptosporidium parvum elongation factor-2
           GB:U21667 GI:706974 from [Cryptosporidium parvum]
          Length = 987

 Score = 33.5 bits (73), Expect = 0.15
 Identities = 17/40 (42%), Positives = 20/40 (50%)
 Frame = +2

Query: 266 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           +  Y   I+D PGH +F   M      AD AVLIV A  G
Sbjct: 206 SKSYLCNIMDTPGHVNFSDEMTASLRLADGAVLIVDAAEG 245


>At4g11160.1 68417.m01808 translation initiation factor IF-2,
           mitochondrial, putative similar to SP|P46198|IF2M_BOVIN
           Translation initiation factor IF-2, mitochondrial
           precursor (IF-2Mt) (IF-2(Mt)) {Bos taurus}
          Length = 743

 Score = 32.7 bits (71), Expect = 0.26
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           +T +D PGH  F +    G +  D  VL+VAA  G
Sbjct: 270 ITFLDTPGHAAFSEMRARGAAVTDIVVLVVAADDG 304


>At3g22980.1 68416.m02898 elongation factor Tu family protein
           similar to eukaryotic translation elongation factor 2
           GB:NP_001952 [Homo sapiens]
          Length = 1015

 Score = 32.7 bits (71), Expect = 0.26
 Identities = 13/25 (52%), Positives = 16/25 (64%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGG 123
           NI ++ HVD GK+T   HLI   GG
Sbjct: 11  NICILAHVDHGKTTLADHLIASSGG 35



 Score = 32.7 bits (71), Expect = 0.26
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = +2

Query: 275 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           Y + +ID+PGH DF   + T    +D A+++V A  G
Sbjct: 74  YSLNLIDSPGHMDFCSEVSTAARLSDGALVLVDAVEG 110


>At1g62750.1 68414.m07082 elongation factor Tu family protein
           similar to elongation factor G SP:P34811 [Glycine max
           (Soybean)]
          Length = 783

 Score = 32.7 bits (71), Expect = 0.26
 Identities = 12/28 (42%), Positives = 20/28 (71%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           K + NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 94  KDYRNIGIMAHIDAGKTTTTERILYYTG 121


>At2g45030.1 68415.m05606 mitochondrial elongation factor, putative
           similar to SP|P25039 Elongation factor G 1,
           mitochondrial precursor (mEF-G-1) {Saccharomyces
           cerevisiae}; contains Pfam profiles PF00009: Elongation
           factor Tu GTP binding domain, PF03764: Elongation factor
           G domain IV, PF00679: Elongation factor G C-terminus
          Length = 754

 Score = 31.9 bits (69), Expect = 0.45
 Identities = 20/62 (32%), Positives = 29/62 (46%)
 Frame = +2

Query: 245 YCSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 424
           YC+ K     Y V IID PGH DF   +       D A+L++ +  G     I+ + Q R
Sbjct: 127 YCTWK----DYKVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSITVDRQMR 182

Query: 425 EH 430
            +
Sbjct: 183 RY 184



 Score = 27.9 bits (59), Expect = 7.3
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGI 126
           NI +  H+DSGK+T T  +++  G I
Sbjct: 67  NIGISAHIDSGKTTLTERVLFYTGRI 92


>At1g45332.1 68414.m05195 mitochondrial elongation factor, putative
           similar to mitochondrial elongation factor GI:3917 from
           [Saccharomyces cerevisiae]
          Length = 754

 Score = 31.9 bits (69), Expect = 0.45
 Identities = 20/62 (32%), Positives = 29/62 (46%)
 Frame = +2

Query: 245 YCSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 424
           YC+ K     Y V IID PGH DF   +       D A+L++ +  G     I+ + Q R
Sbjct: 127 YCTWK----DYKVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSITVDRQMR 182

Query: 425 EH 430
            +
Sbjct: 183 RY 184



 Score = 27.9 bits (59), Expect = 7.3
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGI 126
           NI +  H+DSGK+T T  +++  G I
Sbjct: 67  NIGISAHIDSGKTTLTERVLFYTGRI 92


>At5g08650.1 68418.m01029 GTP-binding protein LepA, putative
          Length = 681

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 13/42 (30%), Positives = 23/42 (54%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           +E + + + +ID PGH DF   +    +  + A+L+V A  G
Sbjct: 147 YEDTPFCLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQG 188



 Score = 28.3 bits (60), Expect = 5.5
 Identities = 11/33 (33%), Positives = 18/33 (54%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEK 147
           N  +I H+D GKST    L+   G +  R +++
Sbjct: 88  NFSIIAHIDHGKSTLADKLLQVTGTVQNRDMKE 120


>At3g01360.1 68416.m00057 expressed protein contains Pfam profile
           PF04819: Family of unknown function (DUF716) (Plant
           viral-response family)
          Length = 319

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 1/71 (1%)
 Frame = +2

Query: 290 IDAPGHRDFIKNMITGTSQADCAV-LIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           I   GH D+ +     T Q +C + L+V   TG F    +KNG  R+       LG +  
Sbjct: 226 IKCKGHGDYHRAKAIATLQFNCHLALMVVVATGLFSVIANKNGYLRQDHSKYRPLGAELE 285

Query: 467 IVGVNKMDSTE 499
            +    +DS E
Sbjct: 286 NLSTFTLDSDE 296


>At1g76720.1 68414.m08929 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to
           SP|O60841 Translation initiation factor IF-2 {Homo
           sapiens}; contains Pfam profiles PF00009: Elongation
           factor Tu GTP binding domain, PF03144: Elongation factor
           Tu domain 2
          Length = 1201

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 21/68 (30%), Positives = 34/68 (50%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           +ID PGH  F      G+S  D A+L+V     + + G+    QT E +L    +   + 
Sbjct: 705 VIDTPGHESFTNLRSRGSSLCDLAILVV-----DIKHGLEP--QTIE-SLNLLRMRNTEF 756

Query: 467 IVGVNKMD 490
           I+ +NK+D
Sbjct: 757 IIALNKVD 764


>At1g21160.1 68414.m02646 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to
           SP|O60841 Translation initiation factor IF-2 {Homo
           sapiens}; contains Pfam profiles PF00009: Elongation
           factor Tu GTP binding domain, PF03144: Elongation factor
           Tu domain 2
          Length = 1088

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 22/70 (31%), Positives = 33/70 (47%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           + +ID PGH  F      G++  D A+L+V     +   G+    QT E   L     VK
Sbjct: 558 ILVIDTPGHESFTNLRSRGSNLCDLAILVV-----DIMRGLEP--QTIESLNLLRRRNVK 610

Query: 461 QLIVGVNKMD 490
             I+ +NK+D
Sbjct: 611 -FIIALNKVD 619


>At1g76825.1 68414.m08940 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to
           SP|O60841 Translation initiation factor IF-2 {Homo
           sapiens}; contains Pfam profile PF00009: Elongation
           factor Tu GTP binding domain
          Length = 630

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIV 370
           +ID PGH  F      G+S  D A+L+V
Sbjct: 113 VIDTPGHESFTNLRSRGSSLCDLAILVV 140


>At1g76810.1 68414.m08938 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to IF2
           protein [Drosophila melanogaster] GI:7108770; contains
           Pfam profile PF03144: Elongation factor Tu domain 2
          Length = 1294

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIV 370
           +ID PGH  F      G+S  D A+L+V
Sbjct: 772 VIDTPGHESFTNLRSRGSSLCDLAILVV 799


>At1g56070.1 68414.m06438 elongation factor 2, putative / EF-2,
           putative similar to ELONGATION FACTOR 2 GB:O14460 from
           [Schizosaccharomyces pombe]
          Length = 843

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 11/34 (32%), Positives = 20/34 (58%)
 Frame = +2

Query: 269 SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 370
           ++Y + +ID+PGH DF   +       D A+++V
Sbjct: 96  NEYLINLIDSPGHVDFSSEVTAALRITDGALVVV 129



 Score = 29.1 bits (62), Expect = 3.2
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCG 120
           N+ VI HVD GKST T  L+   G
Sbjct: 21  NMSVIAHVDHGKSTLTDSLVAAAG 44


>At5g60040.1 68418.m07529 DNA-directed RNA polymerase, putative
           similar to SP|P04051 DNA-directed RNA polymerase III
           largest subunit (EC 2.7.7.6) {Saccharomyces cerevisiae};
           contains InterPro accession IPR000722: RNA polymerase,
           alpha subunit
          Length = 1328

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +2

Query: 536 RKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQPKCLGSRDGQVERKVR 685
           R  PH F ++  +PAA  FV  S + G    E     +G R+G V+  V+
Sbjct: 793 RSLPH-FPRMSKSPAAKGFVANSFYSGLTATEFFFHTMGGREGLVDTAVK 841


>At2g28000.1 68415.m03393 RuBisCO subunit binding-protein alpha
           subunit, chloroplast / 60 kDa chaperonin alpha subunit /
           CPN-60 alpha identical to SWISS-PROT:P21238- RuBisCO
           subunit binding-protein alpha subunit, chloroplast
           precursor (60 kDa chaperonin alpha subunit, CPN-60
           alpha) [Arabidopsis thaliana]
          Length = 586

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 11/44 (25%), Positives = 24/44 (54%)
 Frame = -1

Query: 373 SYDEHSAISLRGSCDHVLDEISVSRSINDGNIVLASFELPRAIS 242
           ++D+HS  +L+   D + D + ++      N+VL  F  P+ ++
Sbjct: 52  AFDQHSRAALQAGIDKLADCVGLTLGPRGRNVVLDEFGSPKVVN 95


>At5g13650.2 68418.m01585 elongation factor family protein contains
           Pfam profiles: PF00009 elongation factor Tu GTP binding
           domain,PF00679 elongation factor G C-terminus,  PF03144
           elongation factor Tu domain 2
          Length = 676

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 26/79 (32%), Positives = 35/79 (44%), Gaps = 2/79 (2%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           V IID PGH DF   +    +  D  +L+V +  G          QTR     A   G  
Sbjct: 148 VNIIDTPGHSDFGGEVERVLNMVDGVLLVVDSVEGPMP-------QTRFVLKKALEFG-H 199

Query: 461 QLIVGVNKMD--STEPPYV 511
            ++V VNK+D  S  P +V
Sbjct: 200 AVVVVVNKIDRPSARPEFV 218


>At5g13650.1 68418.m01584 elongation factor family protein contains
           Pfam profiles: PF00009 elongation factor Tu GTP binding
           domain,PF00679 elongation factor G C-terminus,  PF03144
           elongation factor Tu domain 2
          Length = 675

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 26/79 (32%), Positives = 35/79 (44%), Gaps = 2/79 (2%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           V IID PGH DF   +    +  D  +L+V +  G          QTR     A   G  
Sbjct: 147 VNIIDTPGHSDFGGEVERVLNMVDGVLLVVDSVEGPMP-------QTRFVLKKALEFG-H 198

Query: 461 QLIVGVNKMD--STEPPYV 511
            ++V VNK+D  S  P +V
Sbjct: 199 AVVVVVNKIDRPSARPEFV 217


>At3g08870.1 68416.m01031 lectin protein kinase, putative similar to
           receptor lectin kinase 3 [Arabidopsis thaliana]
           gi|4100060|gb|AAD00733; contains protein kinase domain,
           Pfam:PF00069; contains legume lectins alpha and beta
           domains, Pfam:PF00138 and Pfam:PF00139
          Length = 693

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 14/60 (23%), Positives = 29/60 (48%)
 Frame = -1

Query: 409 LRDTSFEFTGTGSYDEHSAISLRGSCDHVLDEISVSRSINDGNIVLASFELPRAISIVIP 230
           +R+   E    G     + ++L+G C H  + + +   I +G++    ++ PR   IV+P
Sbjct: 406 VREFMAEIESLGRLGHKNLVNLQGWCKHKNELLLIYDYIPNGSLDSLLYQTPRRNGIVLP 465


>At1g20160.1 68414.m02521 subtilase family protein similar to
           subtilisin-type protease precursor GI:14150446 from
           [Glycine max]
          Length = 769

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 15/49 (30%), Positives = 25/49 (51%)
 Frame = +2

Query: 242 RYCSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 388
           RY     + S+YY T  D  GH   + + I G++  + +   VA+GT +
Sbjct: 190 RYYKNPDDDSEYYTTR-DVIGHGSHVSSTIAGSAVENASYYGVASGTAK 237


>At1g17220.1 68414.m02098 translation initiation factor IF-2,
           chloroplast, putative similar to SP|P57997|IF2C_PHAVU
           Translation initiation factor IF-2, chloroplast
           precursor (PvIF2cp) {Phaseolus vulgaris}
          Length = 1026

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 19/67 (28%), Positives = 29/67 (43%)
 Frame = +2

Query: 290 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 469
           +D PGH  F      G    D A+++VAA  G          QT E A+         ++
Sbjct: 557 LDTPGHEAFGAMRARGARVTDIAIIVVAADDG-------IRPQTNE-AIAHAKAAAVPIV 608

Query: 470 VGVNKMD 490
           + +NK+D
Sbjct: 609 IAINKID 615


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,816,359
Number of Sequences: 28952
Number of extensions: 335072
Number of successful extensions: 1017
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 958
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1005
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1594686376
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -