SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30098.Seq
         (617 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g16780.1 68416.m02142 60S ribosomal protein L19 (RPL19B) simi...   130   5e-31
At1g02780.1 68414.m00233 60S ribosomal protein L19 (RPL19A) simi...   128   2e-30
At4g02230.1 68417.m00302 60S ribosomal protein L19 (RPL19C) simi...   128   4e-30
At4g16030.1 68417.m02432 60S ribosomal protein L19, putative sim...    46   3e-05
At5g55390.1 68418.m06901 hydroxyproline-rich glycoprotein family...    31   0.81 
At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC...    30   1.4  
At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC...    30   1.4  
At3g30842.1 68416.m03968 ABC transporter protein, putative simil...    29   3.3  
At1g64690.1 68414.m07333 expressed protein                             29   3.3  
At5g43060.1 68418.m05256 cysteine proteinase, putative / thiol p...    28   5.7  
At5g39460.1 68418.m04779 F-box family protein contains Pfam:PF00...    28   5.7  
At5g01770.1 68418.m00096 transducin family protein / WD-40 repea...    28   5.7  
At2g40420.1 68415.m04985 amino acid transporter family protein s...    28   5.7  
At2g25320.1 68415.m03029 meprin and TRAF homology domain-contain...    28   5.7  
At1g59910.1 68414.m06749 formin homology 2 domain-containing pro...    28   5.7  
At5g67310.1 68418.m08488 cytochrome P450 family protein                27   7.5  
At5g32600.1 68418.m03877 hypothetical protein                          27   7.5  
At3g27260.1 68416.m03407 DNA-binding bromodomain-containing prot...    27   7.5  
At3g20580.1 68416.m02605 phytochelatin synthetase-related contai...    27   7.5  
At3g04340.1 68416.m00459 FtsH protease family protein similar to...    27   7.5  
At2g32000.1 68415.m03910 DNA topoisomerase family protein simila...    27   7.5  
At5g24430.1 68418.m02879 calcium-dependent protein kinase, putat...    27   10.0 
At2g34780.1 68415.m04270 expressed protein                             27   10.0 
At2g32630.1 68415.m03983 pentatricopeptide (PPR) repeat-containi...    27   10.0 
At1g04220.1 68414.m00412 beta-ketoacyl-CoA synthase, putative St...    27   10.0 

>At3g16780.1 68416.m02142 60S ribosomal protein L19 (RPL19B) similar
           to ribosomal protein L19 GB:CAA45090 from [Homo sapiens]
          Length = 209

 Score =  130 bits (315), Expect = 5e-31
 Identities = 57/84 (67%), Positives = 70/84 (83%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           M SLK+QKRLAASVM+CGK KVWLDPNE  +I+  NSRQNIRK++KDG +I+KP  +HSR
Sbjct: 1   MVSLKIQKRLAASVMKCGKGKVWLDPNESGDISMANSRQNIRKLVKDGFIIRKPTKIHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGT 252
           +R R   EA+RKGRH G+GKR+GT
Sbjct: 61  SRARALNEAKRKGRHSGYGKRKGT 84



 Score = 98.7 bits (235), Expect = 3e-21
 Identities = 48/84 (57%), Positives = 56/84 (66%)
 Frame = +3

Query: 258 ARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKK 437
           AR+P K LW                +KKIDRH+YH +YMK KGNVFKNKRVLME IH+ K
Sbjct: 87  ARLPTKILWMRRMRVLRRFLSKYRESKKIDRHMYHDMYMKVKGNVFKNKRVLMESIHKMK 146

Query: 438 AEKARTKMLSDQAEARRNKVKEAR 509
           AEKAR K L+DQ EA+R K K +R
Sbjct: 147 AEKAREKTLADQFEAKRIKNKASR 170


>At1g02780.1 68414.m00233 60S ribosomal protein L19 (RPL19A) similar
           to ribosomal protein L19 GI:36127 from [Homo sapiens]
          Length = 214

 Score =  128 bits (310), Expect = 2e-30
 Identities = 57/84 (67%), Positives = 70/84 (83%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           M SLKLQKRLAASVM+CGK KVWLDPNE ++I+  NSRQNIRK++KDG +I+KP  +HSR
Sbjct: 1   MVSLKLQKRLAASVMKCGKGKVWLDPNESSDISMANSRQNIRKLVKDGFIIRKPTKIHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGT 252
           +R RK   A+ KGRH G+GKR+GT
Sbjct: 61  SRARKMKIAKMKGRHSGYGKRKGT 84



 Score = 98.3 bits (234), Expect = 4e-21
 Identities = 47/84 (55%), Positives = 55/84 (65%)
 Frame = +3

Query: 258 ARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKK 437
           AR+P K LW                 KKID+H+YH +YM+ KGNVFKNKRVLME IH+ K
Sbjct: 87  ARLPTKVLWMRRMRVLRRLLKKYRETKKIDKHMYHDMYMRVKGNVFKNKRVLMESIHKSK 146

Query: 438 AEKARTKMLSDQAEARRNKVKEAR 509
           AEKAR K LSDQ EA+R K K +R
Sbjct: 147 AEKAREKTLSDQFEAKRAKNKASR 170


>At4g02230.1 68417.m00302 60S ribosomal protein L19 (RPL19C) similar
           to L19 from several species
          Length = 208

 Score =  128 bits (308), Expect = 4e-30
 Identities = 55/84 (65%), Positives = 72/84 (85%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           M SLKLQKRLA+SV++CGK+KVWLDPNE ++I+  NSRQNIRK++KDG +I+KP  +HSR
Sbjct: 1   MVSLKLQKRLASSVLKCGKRKVWLDPNEGSDISMANSRQNIRKLVKDGFIIRKPTKIHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGT 252
           +R R+   A+RKGRH G+GKR+GT
Sbjct: 61  SRARQLNIAKRKGRHSGYGKRKGT 84



 Score =  100 bits (240), Expect = 7e-22
 Identities = 49/84 (58%), Positives = 55/84 (65%)
 Frame = +3

Query: 258 ARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKK 437
           AR+P K LW                 KKIDRH+YH +YMK KGNVFKNKRVLME IH+ K
Sbjct: 87  ARLPTKVLWMRRMRVLRRLLKKYRETKKIDRHMYHDMYMKVKGNVFKNKRVLMESIHKSK 146

Query: 438 AEKARTKMLSDQAEARRNKVKEAR 509
           AEKAR K LSDQ EA+R K K +R
Sbjct: 147 AEKAREKTLSDQFEAKRAKNKASR 170


>At4g16030.1 68417.m02432 60S ribosomal protein L19, putative
           similar to 60S ribosomal protein L19-3
           (Swiss-Prot:P49693) [Arabidopsis thaliana]
          Length = 101

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 20/38 (52%), Positives = 28/38 (73%), Gaps = 1/38 (2%)
 Frame = +3

Query: 336 KKIDRHLY-HSLYMKAKGNVFKNKRVLMEYIHRKKAEK 446
           KKID+ +Y H ++MK KG V+KNK VLME +H+   E+
Sbjct: 29  KKIDKLVYYHDMFMKVKGKVYKNKCVLMESMHKSSRER 66


>At5g55390.1 68418.m06901 hydroxyproline-rich glycoprotein family
           protein
          Length = 1332

 Score = 30.7 bits (66), Expect = 0.81
 Identities = 26/87 (29%), Positives = 40/87 (45%), Gaps = 5/87 (5%)
 Frame = +3

Query: 360 HSLYMKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNK--VKEARSAARNVLP 533
           H L      +  K K +     H+   +K++ KM+ D  EA +NK  VKEAR A ++ + 
Sbjct: 495 HGLVSSVPDHSRKRKDIDPSIKHKMVPQKSQ-KMMEDSREAGKNKLGVKEARDAGKSKIS 553

Query: 534 PRRR---NCCRPSLEKTKPRLPLRSKH 605
              R       P+  K    +P+ SKH
Sbjct: 554 LGERLFSYTQEPNPVKPGRVIPVDSKH 580


>At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35
           contains similarity to splicing factor; contains Pfam
           profile PF00076: RNA recognition motif. (a.k.a. RRM,
           RBD, or RNP domain)
          Length = 303

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 21/88 (23%), Positives = 43/88 (48%), Gaps = 5/88 (5%)
 Frame = +3

Query: 360 HSLYMKAKGNVFKNKRVLMEYI-HRKKAEK-ARTKMLSDQAEARRNKVKE---ARSAARN 524
           H    +  G V   + + +++  +   AEK ++ +++    ++RR++ +    +RS  R+
Sbjct: 71  HKAVERLDGRVVDGREITVQFAKYGPNAEKISKGRVVEPPPKSRRSRSRSPRRSRSPRRS 130

Query: 525 VLPPRRRNCCRPSLEKTKPRLPLRSKHY 608
             PPRRR+  R    + + R   R K Y
Sbjct: 131 RSPPRRRSPRRSRSPRRRSRDDYREKDY 158


>At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35
           contains similarity to splicing factor; contains Pfam
           profile PF00076: RNA recognition motif. (a.k.a. RRM,
           RBD, or RNP domain)
          Length = 303

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 21/88 (23%), Positives = 43/88 (48%), Gaps = 5/88 (5%)
 Frame = +3

Query: 360 HSLYMKAKGNVFKNKRVLMEYI-HRKKAEK-ARTKMLSDQAEARRNKVKE---ARSAARN 524
           H    +  G V   + + +++  +   AEK ++ +++    ++RR++ +    +RS  R+
Sbjct: 71  HKAVERLDGRVVDGREITVQFAKYGPNAEKISKGRVVEPPPKSRRSRSRSPRRSRSPRRS 130

Query: 525 VLPPRRRNCCRPSLEKTKPRLPLRSKHY 608
             PPRRR+  R    + + R   R K Y
Sbjct: 131 RSPPRRRSPRRSRSPRRRSRDDYREKDY 158


>At3g30842.1 68416.m03968 ABC transporter protein, putative similar to
            pleiotropic drug resistance like protein [Nicotiana
            tabacum] GI:20522008, ABC1 protein [Nicotiana
            plumbaginifolia] GI:14331118; contains Pfam profile
            PF00005: ABC transporter
          Length = 1406

 Score = 28.7 bits (61), Expect = 3.3
 Identities = 9/24 (37%), Positives = 19/24 (79%)
 Frame = -2

Query: 472  WSLSIFVLAFSAFFLWMYSMSTRL 401
            W +S+ ++AFS FF+++Y+ S ++
Sbjct: 1377 WVVSLTLIAFSMFFVFIYAFSVKI 1400


>At1g64690.1 68414.m07333 expressed protein
          Length = 273

 Score = 28.7 bits (61), Expect = 3.3
 Identities = 18/81 (22%), Positives = 35/81 (43%), Gaps = 3/81 (3%)
 Frame = +3

Query: 339 KIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSD---QAEARRNKVKEAR 509
           ++ R L     M     V + +RV M+ +  +   + +   L +   Q E  RN++ + +
Sbjct: 142 RMKRDLEEERQMHRLAEVLREERVQMKLMDARLFLEEKLSELEEANRQGERERNRMMKPK 201

Query: 510 SAARNVLPPRRRNCCRPSLEK 572
              R    P RR C  P +++
Sbjct: 202 ILERACSSPARRRCENPQIKR 222


>At5g43060.1 68418.m05256 cysteine proteinase, putative / thiol
           protease, putative similar to cysteine proteinase RD21A
           precursor (thiol protease) GI:435619, SP:P43297 from
           [Arabidopsis thaliana]
          Length = 463

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = -1

Query: 161 GFLMTRPSLIILRMFCLELVFAISLISFGSNH 66
           GFL   P +++L M  +     +S+IS+  NH
Sbjct: 2   GFLKLSPMILLLAMIGVSYAMDMSIISYDENH 33


>At5g39460.1 68418.m04779 F-box family protein contains Pfam:PF00646
           F-box domain ; similar to SKP1 interacting partner 2
           (SKIP2) TIGR_Ath1:At5g67250
          Length = 571

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 12/30 (40%), Positives = 17/30 (56%)
 Frame = -2

Query: 553 QQFLLLGGNTFLAALRASFTLLRRASAWSL 464
           +Q  L  GNTF  +L+AS TL+     W +
Sbjct: 347 RQSFLSSGNTFCLSLKASCTLMSSYEGWPI 376


>At5g01770.1 68418.m00096 transducin family protein / WD-40 repeat
           family protein similar to WD-repeat protein mip1
           (SP:P87141) [Schizosaccharomyces pombe]
          Length = 1354

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = -3

Query: 258 HCSTSSLTKATVTTLSTCLCVFADTGAGVDCYRFLDDETILDHL 127
           H +   +  A V  L T L V  D+G GV    F DDE I++ +
Sbjct: 641 HTNLLQVRAAAVFALGTLLDVGFDSGKGVCDEEFDDDENIVEDI 684


>At2g40420.1 68415.m04985 amino acid transporter family protein
           similar to neuronal glutamine transporter [Rattus
           norvegicus] GI:6978016; contains Pfam profile PF01490:
           Transmembrane amino acid transporter protein
          Length = 440

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 20/76 (26%), Positives = 30/76 (39%)
 Frame = -3

Query: 354 DACQSSWQFCTSGAIFLEPFVFVPIVPSVAYAHCSTSSLTKATVTTLSTCLCVFADTGAG 175
           D   S +   T+  + +  F F   V  VA+       L   + T +S  LC    +  G
Sbjct: 218 DGGLSFFSLFTASPVIVTAFTFHFNVHPVAFE--LKDPLNVLSATRISVILCATIYSATG 275

Query: 174 VDCYRFLDDETILDHL 127
           + CY    D T+ D L
Sbjct: 276 LFCYLLFGDSTMTDVL 291


>At2g25320.1 68415.m03029 meprin and TRAF homology domain-containing
            protein / MATH domain-containing protein weak similarity
            to  ubiquitin-specific protease 12 [Arabidopsis thaliana]
            GI:11993471; contains Pfam profile PF00917: MATH domain
          Length = 1663

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 1/40 (2%)
 Frame = -1

Query: 491  IAAGLSLVAKHLRPGLLSLLPVDVLH-EHTLVLEHITLRL 375
            IA  L    KHL+P L+SL+P  V H EH L    +  RL
Sbjct: 974  IALVLDRAPKHLQPDLVSLVPKLVEHSEHPLAALALIERL 1013


>At1g59910.1 68414.m06749 formin homology 2 domain-containing
           protein / FH2 domain-containing protein contains formin
           homology 2 domain, Pfam:PF02128
          Length = 929

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +1

Query: 139 DGLVIKKPVAVHSRARVRKNTEARRKGRHCGFGKRR 246
           D +  KK + + +  ++RKN + RR+G   G G RR
Sbjct: 77  DVIYWKKLLELENSGKIRKNPKPRRRGDKSGDGFRR 112


>At5g67310.1 68418.m08488 cytochrome P450 family protein
          Length = 507

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = -3

Query: 390 HYPSPSCRVSGIDACQSSWQFCTSGAIFLEPFVF 289
           H  S  C V+G D  + +W F  + AI  +P V+
Sbjct: 382 HASSTDCEVAGFDIPRRTWLFINAWAIQRDPNVW 415


>At5g32600.1 68418.m03877 hypothetical protein
          Length = 388

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +3

Query: 453 TKMLSDQAEARRNKVKEARSAARNVLPPR 539
           TK+   +  A++ + KE R A RNVLP R
Sbjct: 160 TKLTLREVYAKKKEDKERRLAERNVLPKR 188


>At3g27260.1 68416.m03407 DNA-binding bromodomain-containing protein
           contains bromodomain, INTERPRO:IPR001487
          Length = 813

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 17/55 (30%), Positives = 30/55 (54%)
 Frame = +3

Query: 381 KGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRRR 545
           KG+  + ++   E + +KK EKAR +  ++ AE  R +  EA +AA      +R+
Sbjct: 562 KGDPERLRKEREELVLQKKKEKARLQAEAEAAEDARRQA-EAEAAAEAAAEAKRK 615


>At3g20580.1 68416.m02605 phytochelatin synthetase-related contains
           Pfam PF04833: Phytochelatin synthetase-like conserved
           region; supporting cDNA gi|26452232|dbj|AK118605.1|
          Length = 672

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = +1

Query: 217 GRHCGFGKRRGTAMRVCHRRNYGYKDK 297
           G  C   KR+G +M VC +RN   K+K
Sbjct: 190 GWECPAAKRKGGSMHVCCKRNPKIKNK 216


>At3g04340.1 68416.m00459 FtsH protease family protein similar to
           chloroplast FtsH protease [Arabidopsis thaliana]
           GI:1483215; contains Pfam profiles PF01434: Peptidase
           family M41, PF00004: ATPase AAA family
          Length = 960

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 13/27 (48%), Positives = 19/27 (70%)
 Frame = +3

Query: 333 AKKIDRHLYHSLYMKAKGNVFKNKRVL 413
           A K+++ +Y   Y KAKG + KN+RVL
Sbjct: 870 AGKVEK-IYDLAYEKAKGMLLKNRRVL 895


>At2g32000.1 68415.m03910 DNA topoisomerase family protein similar
           to DNA topoisomerase III beta-1 (EC 5.99.1.2)(SP:Q9Z321)
           {Mus musculus}
          Length = 865

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = +1

Query: 139 DGLVIKKPVAVHSRARVRKNTEARRKGRHCGFGKRRGT 252
           D L++      H R+ VR+    R +GR  G G RRG+
Sbjct: 816 DELLLSLVEVKHGRSFVRRGGRGRGRGRGRGRGGRRGS 853


>At5g24430.1 68418.m02879 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium/calmodulin-dependent
           protein kinase CaMK1 [Nicotiana tabacum]
           gi|16904222|gb|AAL30818
          Length = 594

 Score = 27.1 bits (57), Expect = 10.0
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 1/66 (1%)
 Frame = +3

Query: 336 KKIDR-HLYHSLYMKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARS 512
           K++ R H  H+ + KAK    KN+ V ++ I + K     T  LS +   R  K+ +A S
Sbjct: 147 KEVGRGHFGHTCWAKAKKGKMKNQTVAVKIISKAK----MTSTLSIEDVRREVKLLKALS 202

Query: 513 AARNVL 530
             R+++
Sbjct: 203 GHRHMV 208


>At2g34780.1 68415.m04270 expressed protein
          Length = 1297

 Score = 27.1 bits (57), Expect = 10.0
 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%)
 Frame = +3

Query: 411 LMEYIHRKKAEKAR-TKMLSDQAEARRNKVKEAR 509
           L + + R   EK+  TK+L DQA  R  ++ E R
Sbjct: 93  LQQKLERNLKEKSEETKLLQDQASGREKEINELR 126


>At2g32630.1 68415.m03983 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 624

 Score = 27.1 bits (57), Expect = 10.0
 Identities = 17/54 (31%), Positives = 28/54 (51%)
 Frame = +3

Query: 366 LYMKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNV 527
           +Y K +GNV + KR+ +E   +     A T  +   A  ++ K+KEAR    N+
Sbjct: 478 VYCK-EGNVEEAKRLFVEMSSKGVQPNAITYNVMIYAYCKQGKIKEARKLRANM 530


>At1g04220.1 68414.m00412 beta-ketoacyl-CoA synthase, putative
           Strong similarity to beta-keto-Coa synthase gb|U37088
           from Simmondsia chinensis, GI:4091810
          Length = 528

 Score = 27.1 bits (57), Expect = 10.0
 Identities = 24/84 (28%), Positives = 36/84 (42%), Gaps = 6/84 (7%)
 Frame = -2

Query: 523 FLAALRASFTLLRRASAWSLSIFVLAFSAFFLWMYSMS------TRLFLNTLPFAFM*SE 362
           FL ++R  +  L      S ++++L      L   S S      T L+ + L F F+ S 
Sbjct: 25  FLLSVRLKYVKLGYHYLISNAVYILILPVGLLAATSSSFSLTDLTLLYNHLLKFHFLSST 84

Query: 361 WYRCLSIFLAVLYFRSNFLRTLCL 290
            +  L IFL  LYF +   R   L
Sbjct: 85  LFAALLIFLTTLYFTTRPRRIFLL 108


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,448,713
Number of Sequences: 28952
Number of extensions: 290262
Number of successful extensions: 928
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 900
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 928
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1246162608
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -