SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30097.Seq
         (631 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g80460.1 68414.m09423 glycerol kinase, putative similar to gl...    48   4e-06
At5g54650.2 68418.m06805 formin homology 2 domain-containing pro...    37   0.013
At5g54650.1 68418.m06804 formin homology 2 domain-containing pro...    37   0.013
At4g30310.3 68417.m04309 ribitol kinase, putative similar to rib...    35   0.051
At4g30310.2 68417.m04308 ribitol kinase, putative similar to rib...    35   0.051
At2g29210.1 68415.m03550 splicing factor PWI domain-containing p...    31   0.83 
At4g24900.1 68417.m03564 expressed protein                             30   1.5  
At1g70620.2 68414.m08137 cyclin-related contains weak similarity...    30   1.5  
At1g74260.1 68414.m08600 AIR synthase-related family protein con...    29   3.4  
At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c...    29   3.4  
At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RS...    28   4.4  
At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RS...    28   4.4  
At5g27420.1 68418.m03273 zinc finger (C3HC4-type RING finger) fa...    28   4.4  
At3g02830.1 68416.m00275 zinc finger (CCCH-type) family protein ...    28   4.4  
At2g40070.1 68415.m04923 expressed protein                             28   4.4  
At1g10520.1 68414.m01184 DNA polymerase lambda (POLL) identical ...    28   4.4  
At5g24480.1 68418.m02885 hypothetical protein similar to unknown...    28   5.9  
At3g14130.1 68416.m01787 (S)-2-hydroxy-acid oxidase, peroxisomal...    28   5.9  
At1g75660.1 68414.m08789 5'-3' exoribonuclease (XRN3) identical ...    28   5.9  
At4g39030.1 68417.m05528 enhanced disease susceptibility 5 (EDS5...    27   7.8  

>At1g80460.1 68414.m09423 glycerol kinase, putative similar to
           glycerol kinase (ATP:glycerol 3-phosphotransferase,
           Glycerokinase, GK)[Mycobacterium tuberculosis]
           Swiss-Prot:O69664
          Length = 522

 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 21/36 (58%), Positives = 29/36 (80%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +Q+QADL+G PV+RP+ +E+TALGAA  AG A+  W
Sbjct: 438 MQIQADLMGSPVVRPVDIETTALGAAYAAGLAVGFW 473


>At5g54650.2 68418.m06805 formin homology 2 domain-containing
           protein / FH2 domain-containing protein contains formin
           homology 2 domain, Pfam:PF02181
          Length = 900

 Score = 36.7 bits (81), Expect = 0.013
 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 3/41 (7%)
 Frame = +1

Query: 514 LSSAPSLRRRGVAS---GARSLQPSRPPRRASGDTRPPARP 627
           LSS   + RR +A+    + S  PSRPP+R+ G  RPP RP
Sbjct: 127 LSSMLDIPRRNLATKPGSSPSPSPSRPPKRSRGPPRPPTRP 167


>At5g54650.1 68418.m06804 formin homology 2 domain-containing
           protein / FH2 domain-containing protein contains formin
           homology 2 domain, Pfam:PF02181
          Length = 900

 Score = 36.7 bits (81), Expect = 0.013
 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 3/41 (7%)
 Frame = +1

Query: 514 LSSAPSLRRRGVAS---GARSLQPSRPPRRASGDTRPPARP 627
           LSS   + RR +A+    + S  PSRPP+R+ G  RPP RP
Sbjct: 127 LSSMLDIPRRNLATKPGSSPSPSPSRPPKRSRGPPRPPTRP 167


>At4g30310.3 68417.m04309 ribitol kinase, putative similar to
           ribitol kinase [Klebsiella pneumoniae]
           gi|2905643|gb|AAC26495
          Length = 451

 Score = 34.7 bits (76), Expect = 0.051
 Identities = 16/38 (42%), Positives = 24/38 (63%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPT 396
           +Q  AD++G P+I P   ES  LGAAI+   A + +P+
Sbjct: 361 IQEHADIVGCPIILPRESESVLLGAAILGAVAGKNYPS 398


>At4g30310.2 68417.m04308 ribitol kinase, putative similar to
           ribitol kinase [Klebsiella pneumoniae]
           gi|2905643|gb|AAC26495
          Length = 579

 Score = 34.7 bits (76), Expect = 0.051
 Identities = 16/38 (42%), Positives = 24/38 (63%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPT 396
           +Q  AD++G P+I P   ES  LGAAI+   A + +P+
Sbjct: 489 IQEHADIVGCPIILPRESESVLLGAAILGAVAGKNYPS 526


>At2g29210.1 68415.m03550 splicing factor PWI domain-containing
           protein contains Pfam profile PF01480: PWI domain
          Length = 878

 Score = 30.7 bits (66), Expect = 0.83
 Identities = 16/36 (44%), Positives = 18/36 (50%)
 Frame = +1

Query: 517 SSAPSLRRRGVASGARSLQPSRPPRRASGDTRPPAR 624
           S APS RRR  +  AR  +   PP R      PPAR
Sbjct: 303 SPAPSRRRRSPSPPARRRRSPSPPARRRRSPSPPAR 338



 Score = 27.9 bits (59), Expect = 5.9
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +1

Query: 520 SAPSLRRRGVASGARSLQPSRPPRRASGDTRPPAR 624
           S P+ RRR  +  AR  +   PP R      PPAR
Sbjct: 314 SPPARRRRSPSPPARRRRSPSPPARRHRSPTPPAR 348



 Score = 27.5 bits (58), Expect = 7.8
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +1

Query: 520 SAPSLRRRGVASGARSLQPSRPPRRASGDTRPPAR 624
           S P+ RRR  +  AR  +   PP R      PPAR
Sbjct: 324 SPPARRRRSPSPPARRHRSPTPPARQRRSPSPPAR 358


>At4g24900.1 68417.m03564 expressed protein
          Length = 421

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 1/52 (1%)
 Frame = -2

Query: 510 CADAG*FTGYTSHSSPHDGK-YSPGGGHCRRSRNACVAHDNTQPTGRYIPAG 358
           C ++G   G+  HS P   K YS  G +C +  N  V+ D  Q  G Y P G
Sbjct: 224 CDESG--NGFGEHSIPCRSKDYSGNGNYCTQE-NYQVSQDKKQIDGSYNPPG 272


>At1g70620.2 68414.m08137 cyclin-related contains weak similarity to
           Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide
           I) [Bos taurus]
          Length = 884

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 23/74 (31%), Positives = 30/74 (40%), Gaps = 1/74 (1%)
 Frame = +2

Query: 398 WATHALRDLRQWPPPGLYFPS*GDE*LVYPVNQPASAQN*VLRHPSV-GEELPQGRAVCS 574
           + TH  +D  Q   PG+ +     +  V P  QP    N    + S  G  LPQ     S
Sbjct: 181 YPTHGYQDFHQQAVPGVSYQQ-HQQFPVPPTTQPERYPNYATGNESFPGVGLPQENLPTS 239

Query: 575 HRVRHGARLVTHGL 616
             +    RLVTH L
Sbjct: 240 SAIHQQERLVTHKL 253


>At1g74260.1 68414.m08600 AIR synthase-related family protein
           contains Pfam profiles: PF00586 AIR synthase related
           protein, N-terminal domain, PF02769 AIR synthase related
           protein, C-terminal domain
          Length = 1387

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = -3

Query: 608 VSPDARRGGRDGCRLRAPEATPRRRRDGAELSSV 507
           V+PD + GG DG  L    A  +RR  G+ L+ V
Sbjct: 898 VTPDLKLGGDDGILLHVDLAKGKRRLGGSALAQV 931


>At1g27750.1 68414.m03391 ubiquitin system component Cue
            domain-containing protein very low similarity to ASC-1
            complex subunit P100 [Homo sapiens] GI:12061187; contains
            Pfam profile PF02845: CUE domain
          Length = 1973

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 5/69 (7%)
 Frame = -1

Query: 388  PAHRPIHSCRLLPMKNEKCGEFVGKKP*INAWDGPILK--MNMST---QKIR*NYCSFAA 224
            P   P+ S RL PM  + CG    K+   + W G + K  ++ ST   Q++  + C +  
Sbjct: 899  PPFSPLLSPRLPPMVTQLCGSEASKQNIGHQWQGALSKSGVHYSTIIAQRLESDICKYII 958

Query: 223  GTFFPRNRP 197
            G+  P   P
Sbjct: 959  GSPEPVQWP 967


>At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RSP41
           (RSP41) nearly identical to SP|P92966
           Arginine/serine-rich splicing factor RSP41 {Arabidopsis
           thaliana}
          Length = 357

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 21/70 (30%), Positives = 28/70 (40%)
 Frame = +1

Query: 409 RIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPP 588
           R A P      R      RGR +  P K A +  +       RR  VAS       +R P
Sbjct: 207 RGASPVAHKRERTSPDYGRGRRSPSPYKRARLSPDYKR-DDRRRERVASPENGAVRNRSP 265

Query: 589 RRASGDTRPP 618
           R+  G++R P
Sbjct: 266 RKGRGESRSP 275


>At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RSP41
           (RSP41) nearly identical to SP|P92966
           Arginine/serine-rich splicing factor RSP41 {Arabidopsis
           thaliana}
          Length = 356

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 21/70 (30%), Positives = 28/70 (40%)
 Frame = +1

Query: 409 RIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPP 588
           R A P      R      RGR +  P K A +  +       RR  VAS       +R P
Sbjct: 207 RGASPVAHKRERTSPDYGRGRRSPSPYKRARLSPDYKR-DDRRRERVASPENGAVRNRSP 265

Query: 589 RRASGDTRPP 618
           R+  G++R P
Sbjct: 266 RKGRGESRSP 275


>At5g27420.1 68418.m03273 zinc finger (C3HC4-type RING finger)
           family protein similar to RING-H2 zinc finger protein
           ATL6 [Arabidopsis thaliana]
           gi|4928403|gb|AAD33584.1|AF132016_1[4928403]; contains
           Pfam domain, PF00097: Zinc finger, C3HC4 type (RING
           finger)
          Length = 368

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 1/50 (2%)
 Frame = -2

Query: 498 G*FTGYTSH-SSPHDGKYSPGGGHCRRSRNACVAHDNTQPTGRYIPAGSY 352
           G FT Y  H +   DG  +P GG  RR  NA VA      T    P   Y
Sbjct: 60  GFFTVYIRHCTGAVDGSVTPAGGARRRVTNATVARGLDAETIETFPTFVY 109


>At3g02830.1 68416.m00275 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 397

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 14/46 (30%), Positives = 17/46 (36%)
 Frame = -2

Query: 486 GYTSHSSPHDGKYSPGGGHCRRSRNACVAHDNTQPTGRYIPAGSYQ 349
           GY   S+  D  Y    GHC+        H   QPT   +P    Q
Sbjct: 127 GYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQ 172


>At2g40070.1 68415.m04923 expressed protein
          Length = 607

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 18/62 (29%), Positives = 28/62 (45%)
 Frame = +1

Query: 415 ARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRR 594
           +RPAT+ +  A  S        + S+       LSS+    RR  +SG    +P+ P  R
Sbjct: 133 SRPATLTSRLANSSTESAARNHLTSRQQTSSPGLSSSSGASRRPSSSGGPGSRPATPTGR 192

Query: 595 AS 600
           +S
Sbjct: 193 SS 194


>At1g10520.1 68414.m01184 DNA polymerase lambda (POLL) identical to
           DNA polymerase lambda GI:12053869 from [Arabidopsis
           thaliana]
          Length = 529

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 13/37 (35%), Positives = 19/37 (51%)
 Frame = -2

Query: 552 GNSSPTEGWRRTQFCADAG*FTGYTSHSSPHDGKYSP 442
           G+   +   +RT++  DAG F G  SHS+      SP
Sbjct: 128 GSEDQSSPQKRTRYSPDAGDFKGVESHSNTQGSPDSP 164


>At5g24480.1 68418.m02885 hypothetical protein similar to unknown
           protein (gb|AAD32930.1)
          Length = 350

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 3/39 (7%)
 Frame = -3

Query: 470 RPLMMESTALGAAIVAGRAMRVWPTTIPSP---PADTFL 363
           RP          ++ + R  R WP T+PSP    A TFL
Sbjct: 10  RPHFQSIHFFDCSLTSDRGQRSWPATLPSPQPLSASTFL 48


>At3g14130.1 68416.m01787 (S)-2-hydroxy-acid oxidase, peroxisomal,
           putative / glycolate oxidase, putative / short chain
           alpha-hydroxy acid oxidase, putative similar to Chain A,
           Glycolate Oxidase (E.C.1.1.3.15) Mutant With Tyr 24
           Replaced By Phe (Y24f) gi|999542
          Length = 363

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 11/33 (33%), Positives = 20/33 (60%)
 Frame = -3

Query: 539 RRRDGAELSSVQMQADLLGIPVIRPLMMESTAL 441
           R R   ++S++ M   +LG P+  P+M+  TA+
Sbjct: 49  RPRVLVDVSNIDMSTSMLGYPISAPIMIAPTAM 81


>At1g75660.1 68414.m08789 5'-3' exoribonuclease (XRN3) identical to
            XRN3 [Arabidopsis thaliana] gi|11875628|gb|AAG40732
          Length = 1020

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 24/85 (28%), Positives = 34/85 (40%)
 Frame = +2

Query: 377  PVGWVLSWATHALRDLRQWPPPGLYFPS*GDE*LVYPVNQPASAQN*VLRHPSVGEELPQ 556
            P G +    T  + DL+  PPP L+    G      P++      N    H + G + P 
Sbjct: 798  PPGVIFPKKTVDIGDLK--PPPALWHEDNGRR----PMHNNHGMHNNHGMHNNQGRQNPP 851

Query: 557  GRAVCSHRVRHGARLVTHGLQRGPD 631
            G     H      RLV++ LQ G D
Sbjct: 852  GSVSGRHLGNAAHRLVSNSLQMGTD 876


>At4g39030.1 68417.m05528 enhanced disease susceptibility 5 (EDS5) /
           salicylic acid induction deficient 1 (SID1) identical to
           SP|Q945F0; contains Pfam profile PF01554:
           Uncharacterized membrane protein family
          Length = 543

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 13/30 (43%), Positives = 15/30 (50%)
 Frame = -1

Query: 442 WGRPLSQVAQCVCGPRQYPAHRPIHSCRLL 353
           WG PLSQ AQ       Y A+R +   R L
Sbjct: 371 WGEPLSQTAQSFMPEMLYGANRNLPKARTL 400


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,588,824
Number of Sequences: 28952
Number of extensions: 301942
Number of successful extensions: 760
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 709
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 760
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1285411824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -