SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30090.Seq
         (437 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) simi...    55   2e-08
At3g06700.1 68416.m00792 60S ribosomal protein L29 (RPL29A) simi...    55   2e-08
At1g14350.1 68414.m01701 myb family transcription factor (MYB124...    27   5.5  

>At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) similar
           to 60S ribosomal protein L29 GB:P25886 from (Rattus
           norvegicus)
          Length = 83

 Score = 55.2 bits (127), Expect = 2e-08
 Identities = 25/49 (51%), Positives = 32/49 (65%)
 Frame = +3

Query: 162 KMAKXXNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARR 308
           +MAK  NHT HNQ+ KAH+NGIKKPR+ RH P       F   + +AR+
Sbjct: 22  EMAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARK 70



 Score = 38.7 bits (86), Expect = 0.002
 Identities = 16/31 (51%), Positives = 22/31 (70%)
 Frame = +2

Query: 227 QKAKEDQARTTLGMDPKFLRNQRFCKKGNLK 319
           +K +  +   T GMDPKFLRNQR+ +K N+K
Sbjct: 44  KKPRRHRHTPTRGMDPKFLRNQRYARKHNVK 74


>At3g06700.1 68416.m00792 60S ribosomal protein L29 (RPL29A) similar
           to ribosomal protein L29 GI:7959366 [Panax ginseng]
          Length = 61

 Score = 54.8 bits (126), Expect = 2e-08
 Identities = 25/48 (52%), Positives = 31/48 (64%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARR 308
           MAK  NHT HNQ+ KAH+NGIKKPR+ RH P       F   + +AR+
Sbjct: 1   MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARK 48



 Score = 38.7 bits (86), Expect = 0.002
 Identities = 16/31 (51%), Positives = 22/31 (70%)
 Frame = +2

Query: 227 QKAKEDQARTTLGMDPKFLRNQRFCKKGNLK 319
           +K +  +   T GMDPKFLRNQR+ +K N+K
Sbjct: 22  KKPRRHRHTPTRGMDPKFLRNQRYARKHNVK 52


>At1g14350.1 68414.m01701 myb family transcription factor (MYB124)
           contains PFAM profile: PF00249 myb-like DNA binding
           domain
          Length = 436

 Score = 27.1 bits (57), Expect = 5.5
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = +3

Query: 186 TNHNQNRKAHRNGIKKPRKTRHEPPLA 266
           +N N  R    +GI  PRK+ +E P+A
Sbjct: 135 SNSNTKRMLFLDGISTPRKSENETPIA 161


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,490,174
Number of Sequences: 28952
Number of extensions: 125334
Number of successful extensions: 300
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 298
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 300
length of database: 12,070,560
effective HSP length: 75
effective length of database: 9,899,160
effective search space used: 692941200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -