SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30079.Seq
         (413 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g16070.2 68415.m01843 expressed protein                             26   8.7  
At2g16070.1 68415.m01842 expressed protein                             26   8.7  
At1g11390.1 68414.m01308 ABC1 family protein contains Pfam domai...    26   8.7  

>At2g16070.2 68415.m01843 expressed protein
          Length = 307

 Score = 26.2 bits (55), Expect = 8.7
 Identities = 11/29 (37%), Positives = 16/29 (55%)
 Frame = -1

Query: 98  NLTTVFDNDSLRGLLVPNSCTPGXPLLLE 12
           NL  +  + + RG   PN C PG  L++E
Sbjct: 249 NLFGLLPHRATRGKRTPNQCPPGKVLVIE 277


>At2g16070.1 68415.m01842 expressed protein
          Length = 224

 Score = 26.2 bits (55), Expect = 8.7
 Identities = 11/29 (37%), Positives = 16/29 (55%)
 Frame = -1

Query: 98  NLTTVFDNDSLRGLLVPNSCTPGXPLLLE 12
           NL  +  + + RG   PN C PG  L++E
Sbjct: 166 NLFGLLPHRATRGKRTPNQCPPGKVLVIE 194


>At1g11390.1 68414.m01308 ABC1 family protein contains Pfam domain,
           PF03109: ABC1 family
          Length = 624

 Score = 26.2 bits (55), Expect = 8.7
 Identities = 14/36 (38%), Positives = 17/36 (47%)
 Frame = +3

Query: 276 HALLVCSLLHFCYYXXISTSSLAVCLDLNNSHYRRP 383
           HA +    LH+ Y   IST + A  L L  SH   P
Sbjct: 91  HAQIAWRRLHYKYSERISTIAQAFSLSLTRSHLLIP 126


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,097,963
Number of Sequences: 28952
Number of extensions: 113407
Number of successful extensions: 151
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 150
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 151
length of database: 12,070,560
effective HSP length: 74
effective length of database: 9,928,112
effective search space used: 625471056
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -