SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30044.Seq
         (443 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) simi...    60   9e-10
At3g06700.1 68416.m00792 60S ribosomal protein L29 (RPL29A) simi...    59   1e-09
At4g10220.1 68417.m01676 hypothetical protein IB1C3-1 protein, A...    27   5.7  
At1g14350.1 68414.m01701 myb family transcription factor (MYB124...    27   5.7  
At2g03600.1 68415.m00320 hypothetical protein similar to SP|Q417...    27   7.5  
At4g35940.1 68417.m05113 expressed protein                             26   10.0 
At4g01925.1 68417.m00256 DC1 domain-containing protein low simil...    26   10.0 
At3g13760.1 68416.m01736 DC1 domain-containing protein contains ...    26   10.0 
At1g62720.1 68414.m07079 pentatricopeptide (PPR) repeat-containi...    26   10.0 

>At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) similar
           to 60S ribosomal protein L29 GB:P25886 from (Rattus
           norvegicus)
          Length = 83

 Score = 59.7 bits (138), Expect = 9e-10
 Identities = 27/49 (55%), Positives = 34/49 (69%)
 Frame = +3

Query: 162 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARR 308
           +MAKSKNHT HNQ+ KAH+NGIKKPR+ RH P       F   + +AR+
Sbjct: 22  EMAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARK 70



 Score = 37.5 bits (83), Expect = 0.004
 Identities = 15/21 (71%), Positives = 18/21 (85%)
 Frame = +2

Query: 257 TLGMDPKFLRNQRFCKKGNLK 319
           T GMDPKFLRNQR+ +K N+K
Sbjct: 54  TRGMDPKFLRNQRYARKHNVK 74


>At3g06700.1 68416.m00792 60S ribosomal protein L29 (RPL29A) similar
           to ribosomal protein L29 GI:7959366 [Panax ginseng]
          Length = 61

 Score = 59.3 bits (137), Expect = 1e-09
 Identities = 27/48 (56%), Positives = 33/48 (68%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARR 308
           MAKSKNHT HNQ+ KAH+NGIKKPR+ RH P       F   + +AR+
Sbjct: 1   MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARK 48



 Score = 37.5 bits (83), Expect = 0.004
 Identities = 15/21 (71%), Positives = 18/21 (85%)
 Frame = +2

Query: 257 TLGMDPKFLRNQRFCKKGNLK 319
           T GMDPKFLRNQR+ +K N+K
Sbjct: 32  TRGMDPKFLRNQRYARKHNVK 52


>At4g10220.1 68417.m01676 hypothetical protein IB1C3-1 protein,
           Arabidopsis thaliana, AJ011845
          Length = 400

 Score = 27.1 bits (57), Expect = 5.7
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = +3

Query: 177 KNHTNHNQNRKAHRNGIKKPRKT 245
           KNHT H++ R ++  G K  RKT
Sbjct: 88  KNHTFHHKMRMSYSEGSKMKRKT 110


>At1g14350.1 68414.m01701 myb family transcription factor (MYB124)
           contains PFAM profile: PF00249 myb-like DNA binding
           domain
          Length = 436

 Score = 27.1 bits (57), Expect = 5.7
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = +3

Query: 186 TNHNQNRKAHRNGIKKPRKTRHEPPLA 266
           +N N  R    +GI  PRK+ +E P+A
Sbjct: 135 SNSNTKRMLFLDGISTPRKSENETPIA 161


>At2g03600.1 68415.m00320 hypothetical protein similar to SP|Q41706
           A3 protein (unknown function) {Vigna unguiculata}
          Length = 344

 Score = 26.6 bits (56), Expect = 7.5
 Identities = 9/24 (37%), Positives = 15/24 (62%)
 Frame = -1

Query: 437 FFFVXRSFXAXICLXLMFISWPLL 366
           F+F   SF   + L ++F+ WP+L
Sbjct: 238 FYFSISSFGVGLILNIIFLYWPIL 261


>At4g35940.1 68417.m05113 expressed protein
          Length = 451

 Score = 26.2 bits (55), Expect = 10.0
 Identities = 18/67 (26%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
 Frame = +3

Query: 183 HTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GI--KGFARRVT*SQPSNSRGRLREK 356
           H N+N+ R   +  +       +E  +   Q   G       +R+   QP N R   +EK
Sbjct: 188 HNNNNEKRIEKQQPLNGRHNNNNEKLMEKQQPLNGRHNNNNEKRIEKQQPLNGRHNNKEK 247

Query: 357 LPEKQRP 377
             EKQ+P
Sbjct: 248 QKEKQQP 254


>At4g01925.1 68417.m00256 DC1 domain-containing protein low
           similarity to UV-B light insensitive ULI3 [Arabidopsis
           thaliana] GI:17225050; contains Pfam profile PF03107:
           DC1 domain
          Length = 399

 Score = 26.2 bits (55), Expect = 10.0
 Identities = 11/20 (55%), Positives = 13/20 (65%)
 Frame = -3

Query: 225 YHFCELCGFGYDLYDSLTLP 166
           YH CE CGF  DLY ++  P
Sbjct: 65  YH-CETCGFDVDLYCAMYPP 83


>At3g13760.1 68416.m01736 DC1 domain-containing protein contains
           Pfam profile PF03107: DC1 domain
          Length = 652

 Score = 26.2 bits (55), Expect = 10.0
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = -3

Query: 225 YHFCELCGFGYDLYDSLTLPF**VFNP 145
           ++ C +CGF  DL  +LTLP   + NP
Sbjct: 182 FYRCLICGFCLDLSCALTLPPLTIANP 208


>At1g62720.1 68414.m07079 pentatricopeptide (PPR) repeat-containing
           protein contains multiple PPR repeats Pfam Profile:
           PF01535
          Length = 426

 Score = 26.2 bits (55), Expect = 10.0
 Identities = 8/14 (57%), Positives = 11/14 (78%)
 Frame = -3

Query: 225 YHFCELCGFGYDLY 184
           +H  E+CG G+DLY
Sbjct: 33  FHHMEVCGIGHDLY 46


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,794,978
Number of Sequences: 28952
Number of extensions: 135255
Number of successful extensions: 348
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 345
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 348
length of database: 12,070,560
effective HSP length: 75
effective length of database: 9,899,160
effective search space used: 712739520
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -