SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30018.Seq
         (825 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g21970.1 68417.m03180 expressed protein contains Pfam profile...    31   1.2  
At2g24570.1 68415.m02934 WRKY family transcription factor identi...    30   1.6  
At5g27030.1 68418.m03224 WD-40 repeat family protein contains 8 ...    29   3.7  
At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 ...    29   3.7  
At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 ...    29   3.7  
At4g23230.1 68417.m03350 protein kinase family protein contains ...    29   5.0  
At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10...    29   5.0  
At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10...    29   5.0  
At3g15880.2 68416.m02009 WD-40 repeat family protein contains Pf...    28   8.7  
At3g15880.1 68416.m02008 WD-40 repeat family protein contains Pf...    28   8.7  
At1g18830.1 68414.m02345 transducin family protein / WD-40 repea...    28   8.7  

>At4g21970.1 68417.m03180 expressed protein contains Pfam profile
           PF04520: Protein of unknown function, DUF584; expression
           supported by MPSS
          Length = 181

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 13/35 (37%), Positives = 18/35 (51%)
 Frame = +1

Query: 286 AKHFSAKVTALDWSRKYGLYSCTKDSRVYEWNIED 390
           AK  SA +   DWS+ YG       S ++ W I+D
Sbjct: 56  AKQSSAPMNIPDWSKVYGYSKKNTSSHLHSWAIDD 90


>At2g24570.1 68415.m02934 WRKY family transcription factor identical
           to WRKY transcription factor 17 GI:15991743 from
           [Arabidopsis thaliana]
          Length = 321

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 23/66 (34%), Positives = 30/66 (45%)
 Frame = +1

Query: 316 LDWSRKYGLYSCTKDSRVYEWNIEDGSVKQTYNISIENNTKQGSHINAIKIIPHNPAPAI 495
           LD++R     + TK S V E+  E  SV    +      T  GS      I    PAPA+
Sbjct: 117 LDFTRPSVFGAKTKSSEVVEFAKESFSVSSNSSFMSSAITGDGSVSKGSSIFLA-PAPAV 175

Query: 496 PVLSTG 513
           PV S+G
Sbjct: 176 PVTSSG 181


>At5g27030.1 68418.m03224 WD-40 repeat family protein contains 8
           WD-40 repeats (PF00400) (2 weak)
          Length = 1108

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = +1

Query: 244 ILNNQAKIINVWVPAKHFSAKVTALDWSRKYGL-YSCTKDSRVYEWNIEDGSVKQTY 411
           + +N    ++   P K  +  + + D +R +    S   DS + EWN  +GS+K+TY
Sbjct: 525 LYDNLGSRVDYDAPGKWCTRMLYSADGTRLFSCGTSKDGDSFLVEWNESEGSIKRTY 581


>At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9
           WD-40 repeats domain (PF00400) (6 weak)
          Length = 1120

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 4/60 (6%)
 Frame = +1

Query: 244 ILNNQAKIINVWVPAKHFSAKVTALDWSRKYGLYSC--TKD--SRVYEWNIEDGSVKQTY 411
           + +N    ++   P +  +    + D +R   L+SC  +KD  S + EWN  +G+VK+TY
Sbjct: 536 LYDNMGSRVDYEAPGRWCTTMAYSADGTR---LFSCGTSKDGESFIVEWNESEGAVKRTY 592


>At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9
           WD-40 repeats domain (PF00400) (6 weak)
          Length = 1120

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 4/60 (6%)
 Frame = +1

Query: 244 ILNNQAKIINVWVPAKHFSAKVTALDWSRKYGLYSC--TKD--SRVYEWNIEDGSVKQTY 411
           + +N    ++   P +  +    + D +R   L+SC  +KD  S + EWN  +G+VK+TY
Sbjct: 536 LYDNMGSRVDYEAPGRWCTTMAYSADGTR---LFSCGTSKDGESFIVEWNESEGAVKRTY 592


>At4g23230.1 68417.m03350 protein kinase family protein contains
           Pfam domain PF00069: Protein kinase domain
          Length = 507

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 26/106 (24%), Positives = 44/106 (41%), Gaps = 10/106 (9%)
 Frame = +1

Query: 253 NQAKIINVWVPAKHFSAKVTALDWSRKYGLYSCTKD-SRVYEWNIEDGSVK--------- 402
           NQA +     P K ++ K T       YGL  CT D +R   ++  + S+K         
Sbjct: 45  NQAAVKAASSPRKFYTVKATWTALQTLYGLVQCTPDLTRQDCFSCLESSIKLMPLYKTGG 104

Query: 403 QTYNISIENNTKQGSHINAIKIIPHNPAPAIPVLSTGIISAQSLEG 540
           +T   S  +  +  +  N   +      P +P  ST ++++ SL G
Sbjct: 105 RTLYSSCNSRYELFAFYNETTVRTQQAPPPLPPSSTPLVTSPSLPG 150


>At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10
           WD-40 repeats (PF00400) (1 weak)
          Length = 1131

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 4/60 (6%)
 Frame = +1

Query: 244 ILNNQAKIINVWVPAKHFSAKVTALDWSRKYGLYSC--TKD--SRVYEWNIEDGSVKQTY 411
           + +N    ++   P +  +    + D +R   L+SC  +KD  S + EWN  +G+VK+TY
Sbjct: 536 LYDNMGSRVDYDAPGRWCTTMAYSADGTR---LFSCGTSKDGESFIVEWNESEGAVKRTY 592


>At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10
           WD-40 repeats (PF00400) (1 weak)
          Length = 1131

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 4/60 (6%)
 Frame = +1

Query: 244 ILNNQAKIINVWVPAKHFSAKVTALDWSRKYGLYSC--TKD--SRVYEWNIEDGSVKQTY 411
           + +N    ++   P +  +    + D +R   L+SC  +KD  S + EWN  +G+VK+TY
Sbjct: 536 LYDNMGSRVDYDAPGRWCTTMAYSADGTR---LFSCGTSKDGESFIVEWNESEGAVKRTY 592


>At3g15880.2 68416.m02009 WD-40 repeat family protein contains Pfam
           profile: PF00400 WD domain, G-beta repeat (7 copies)
          Length = 1135

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = +1

Query: 244 ILNNQAKIINVWVPAKHFSAKVTALDWSRKYGLYSCTK-DSRVYEWNIEDGSVKQTY 411
           + +N    ++   P +  ++     D +R +   +  + +S + EWN  +G+VK+TY
Sbjct: 538 LYDNMGSRVDYDAPGRSCTSMAYCADGTRLFSCGTSKEGESFIVEWNESEGAVKRTY 594


>At3g15880.1 68416.m02008 WD-40 repeat family protein contains Pfam
           profile: PF00400 WD domain, G-beta repeat (7 copies)
          Length = 1137

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = +1

Query: 244 ILNNQAKIINVWVPAKHFSAKVTALDWSRKYGLYSCTK-DSRVYEWNIEDGSVKQTY 411
           + +N    ++   P +  ++     D +R +   +  + +S + EWN  +G+VK+TY
Sbjct: 538 LYDNMGSRVDYDAPGRSCTSMAYCADGTRLFSCGTSKEGESFIVEWNESEGAVKRTY 594


>At1g18830.1 68414.m02345 transducin family protein / WD-40 repeat
           family protein similar to Sec31p (GI:13928450)  {Oryza
           sativa}
          Length = 969

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 2/33 (6%)
 Frame = +1

Query: 307 VTALDWSRKYGLY--SCTKDSRVYEWNIEDGSV 399
           V A++W     LY  +C KD+R   WN + G +
Sbjct: 255 VIAMEWCPSDSLYLLTCGKDNRTICWNTKTGKI 287


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,567,658
Number of Sequences: 28952
Number of extensions: 303792
Number of successful extensions: 709
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 689
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 709
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1892353600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -