SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30011.Seq
         (628 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g66580.1 68414.m07565 60S ribosomal protein L10 (RPL10C) cont...   130   1e-30
At1g14320.1 68414.m01697 60S ribosomal protein L10 (RPL10A) / Wi...   130   1e-30
At1g26910.1 68414.m03281 60S ribosomal protein L10 (RPL10B) Near...   129   1e-30
At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33...    29   2.5  

>At1g66580.1 68414.m07565 60S ribosomal protein L10 (RPL10C)
           contains Pfam profile: PF00826: Ribosomal L10
          Length = 221

 Score =  130 bits (313), Expect = 1e-30
 Identities = 58/85 (68%), Positives = 65/85 (76%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYR  K KPYPKSR  RGVPDPKIRI+D+G     VD+FP CVHLVS E E +SSE
Sbjct: 4   RPARCYRQIKGKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPFCVHLVSWEKENVSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RI CN Y+VK+ G D FH+R
Sbjct: 64  ALEAARIACNKYMVKSAGKDAFHLR 88



 Score =  107 bits (258), Expect = 5e-24
 Identities = 55/97 (56%), Positives = 67/97 (69%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +R+HPFHV+RINKMLSCAGAD LQTGMR AFGK  GT ARV IGQ ++SVR      G  
Sbjct: 89  IRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKALGTCARVAIGQVLLSVRC-KDNHGVH 147

Query: 435 HRGSAPSPSFKFPGRAKDLRIKEVGFTKYERDEFXKL 545
            + +     FKFPGR K +  ++ GFTK+ R E+ KL
Sbjct: 148 AQEALRRAKFKFPGRQKIIVSRKWGFTKFNRAEYTKL 184


>At1g14320.1 68414.m01697 60S ribosomal protein L10 (RPL10A) /
           Wilm's tumor suppressor protein-related similar to tumor
           suppressor GI:575354 from [Oryza sativa]
          Length = 220

 Score =  130 bits (313), Expect = 1e-30
 Identities = 58/85 (68%), Positives = 65/85 (76%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYR  K KPYPKSR  RGVPDPKIRI+D+G     VD+FP CVHLVS E E +SSE
Sbjct: 4   RPARCYRQIKGKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPFCVHLVSWEKENVSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RI CN Y+VK+ G D FH+R
Sbjct: 64  ALEAARIACNKYMVKSAGKDAFHLR 88



 Score =  108 bits (259), Expect = 3e-24
 Identities = 55/97 (56%), Positives = 67/97 (69%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +R+HPFHV+RINKMLSCAGAD LQTGMR AFGK  GT ARV IGQ ++SVR      G  
Sbjct: 89  IRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKALGTCARVAIGQVLLSVRC-KDAHGHH 147

Query: 435 HRGSAPSPSFKFPGRAKDLRIKEVGFTKYERDEFXKL 545
            + +     FKFPGR K +  ++ GFTK+ R +F KL
Sbjct: 148 AQEALRRAKFKFPGRQKIIVSRKWGFTKFNRADFTKL 184


>At1g26910.1 68414.m03281 60S ribosomal protein L10 (RPL10B) Nearly
           identical to ribosomal protein L10.e, Wilm's tumor
           suppressor homologue, gi|17682 (Z15157), however
           differences in sequence indicate this is a different
           member of the L10 family
          Length = 221

 Score =  129 bits (312), Expect = 1e-30
 Identities = 58/85 (68%), Positives = 65/85 (76%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYR  K KPYPKSR  RGVPDPKIRI+D+G     VD+FP CVHLVS E E +SSE
Sbjct: 4   RPARCYRQIKGKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPYCVHLVSWEKENVSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RI CN Y+VK+ G D FH+R
Sbjct: 64  ALEAARIACNKYMVKSAGKDAFHLR 88



 Score =  107 bits (256), Expect = 8e-24
 Identities = 54/97 (55%), Positives = 67/97 (69%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +R+HPFHV+RINKMLSCAGAD LQTGMR AFGK  GT ARV IGQ ++SVR      G  
Sbjct: 89  IRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKALGTCARVAIGQVLLSVRC-KDAHGHH 147

Query: 435 HRGSAPSPSFKFPGRAKDLRIKEVGFTKYERDEFXKL 545
            + +     FKFPGR K +  ++ GFTK+ R ++ KL
Sbjct: 148 AQEALRRAKFKFPGRQKIIVSRKWGFTKFNRADYTKL 184


>At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33)
           nearly identical to SC35-like splicing factor SCL33, 33
           kD [Arabidopsis thaliana] GI:9843659
          Length = 220

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 11/22 (50%), Positives = 16/22 (72%)
 Frame = +3

Query: 426 GTGHRGSAPSPSFKFPGRAKDL 491
           G G RG +PSP  ++ GR++DL
Sbjct: 13  GYGRRGRSPSPRGRYGGRSRDL 34


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,334,952
Number of Sequences: 28952
Number of extensions: 230263
Number of successful extensions: 527
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 515
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 524
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1275599520
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -