Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS301F03f
         (408 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g11710.1 68418.m01368 epsin N-terminal homology (ENTH) domain...    29   1.6  

>At5g11710.1 68418.m01368 epsin N-terminal homology (ENTH)
           domain-containing protein / clathrin assembly
           protein-related contains Pfam PF01417: ENTH domain. ENTH
           (Epsin N-terminal homology) domain; similar to
           Af10-protein (GI:1724114) [Avena fatua]; similar to
           clathrin assembly protein AP180 (GI:6492344) [Xenopus
           laevis]; Af10-protein, Avena fatua, EMBL:U80041
          Length = 560

 Score = 28.7 bits (61), Expect = 1.6
 Identities = 13/42 (30%), Positives = 20/42 (47%)
 Frame = -2

Query: 383 KHASYLLALTSRHYVTDNNRDVALTPNDHLIRSITILKNKRK 258
           +H   + +LTS  YV  N +DV +         + +L NK K
Sbjct: 106 EHTYQISSLTSFEYVEPNGKDVGINVRKKAENIVALLNNKEK 147


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,907,880
Number of Sequences: 28952
Number of extensions: 132558
Number of successful extensions: 254
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 253
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 254
length of database: 12,070,560
effective HSP length: 74
effective length of database: 9,928,112
effective search space used: 605614832
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)