BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30125 (477 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g53870.1 68416.m05951 40S ribosomal protein S3 (RPS3B) riboso... 146 5e-36 At2g31610.1 68415.m03862 40S ribosomal protein S3 (RPS3A) 146 7e-36 At5g35530.1 68418.m04226 40S ribosomal protein S3 (RPS3C) 145 1e-35 At1g09830.1 68414.m01105 phosphoribosylamine--glycine ligase (PU... 28 3.8 At5g09280.1 68418.m01075 pectate lyase family protein similar to... 27 6.6 At5g48320.1 68418.m05969 DC1 domain-containing protein contains ... 27 8.7 At3g46050.1 68416.m04983 kelch repeat-containing F-box family pr... 27 8.7 >At3g53870.1 68416.m05951 40S ribosomal protein S3 (RPS3B) ribosomal protein S3a - Xenopus laevis, PIR:R3XL3A Length = 249 Score = 146 bits (355), Expect = 5e-36 Identities = 67/87 (77%), Positives = 77/87 (88%) Frame = +3 Query: 3 QAESLRYKLIGGLAVRRACYGVLRFIMESGARGCEVVVSGKLRGQRAKSMKFVDGLMIHS 182 QAESLRYKL+GGLAVRRACYGVLRF+MESGA+GCEV+VSGKLR RAKSMKF DG M+ S Sbjct: 101 QAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAARAKSMKFKDGYMVSS 160 Query: 183 GDPCNDYVNTATRHVLLRQGVLGIRSK 263 G P +Y+++A RHVLLRQGVLGI+ K Sbjct: 161 GQPTKEYIDSAVRHVLLRQGVLGIKVK 187 Score = 44.4 bits (100), Expect = 4e-05 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = +2 Query: 254 QVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPVPLEP 367 +VK+ML WD +G +GPK P PD +++ PK+E P Sbjct: 185 KVKVMLDWDPKGISGPKTPLPDVVIIHSPKEEEAIYAP 222 >At2g31610.1 68415.m03862 40S ribosomal protein S3 (RPS3A) Length = 250 Score = 146 bits (354), Expect = 7e-36 Identities = 67/87 (77%), Positives = 76/87 (87%) Frame = +3 Query: 3 QAESLRYKLIGGLAVRRACYGVLRFIMESGARGCEVVVSGKLRGQRAKSMKFVDGLMIHS 182 QAESLRYKL+GGLAVRRACYGVLRF+MESGA+GCEV+VSGKLR RAKSMKF DG M+ S Sbjct: 101 QAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAARAKSMKFKDGYMVSS 160 Query: 183 GDPCNDYVNTATRHVLLRQGVLGIRSK 263 G P +Y++ A RHVLLRQGVLGI+ K Sbjct: 161 GQPTKEYIDAAVRHVLLRQGVLGIKVK 187 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/38 (52%), Positives = 26/38 (68%) Frame = +2 Query: 254 QVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPVPLEP 367 +VKIML WD GK+GPK P PD +++ PKD+ V P Sbjct: 185 KVKIMLDWDPTGKSGPKTPLPDVVIIHAPKDDVVYSAP 222 >At5g35530.1 68418.m04226 40S ribosomal protein S3 (RPS3C) Length = 248 Score = 145 bits (352), Expect = 1e-35 Identities = 66/87 (75%), Positives = 76/87 (87%) Frame = +3 Query: 3 QAESLRYKLIGGLAVRRACYGVLRFIMESGARGCEVVVSGKLRGQRAKSMKFVDGLMIHS 182 QAESLRYKL+GGLAVRRACYGVLRF+MESGA+GCEV+VSGKLR RAKSMKF DG M+ S Sbjct: 101 QAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAARAKSMKFKDGYMVSS 160 Query: 183 GDPCNDYVNTATRHVLLRQGVLGIRSK 263 G P +Y++ A RHVLLRQGVLG++ K Sbjct: 161 GQPTKEYIDAAVRHVLLRQGVLGLKVK 187 Score = 47.2 bits (107), Expect = 6e-06 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = +2 Query: 254 QVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPVPLEPTSEV 379 +VKIML WD +GK GP P PD +++ PK++ V + P V Sbjct: 185 KVKIMLDWDPKGKQGPMTPLPDVVIIHTPKEDDVYIAPAQVV 226 >At1g09830.1 68414.m01105 phosphoribosylamine--glycine ligase (PUR2) Identical to phosphoribosylamine--glycine ligase, chloroplast [precursor] SP:P52420 from [Arabidopsis thaliana] Length = 532 Score = 27.9 bits (59), Expect = 3.8 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 90 GARGCEVVVSGKLRGQRAKSMKFVDG 167 G+ GC+VVV L G+ A VDG Sbjct: 273 GSAGCQVVVEEFLEGEEASFFALVDG 298 >At5g09280.1 68418.m01075 pectate lyase family protein similar to major pollen allergen Cup a 1 SP:Q9SCG9 from [Cupressus arizonica] Length = 297 Score = 27.1 bits (57), Expect = 6.6 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = -2 Query: 290 CLAGPTAT*F*PDS*YSLPEKHMSGSSVDVIIARVSRVDHESIY 159 C A P ++ PDS + HM G ++ ++ A+ +DH ++Y Sbjct: 97 CKAHPPSSVMGPDS-KIIQLGHMDGDAIRLVTAKKVWIDHNTLY 139 >At5g48320.1 68418.m05969 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 977 Score = 26.6 bits (56), Expect = 8.7 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 305 KPQPDHILVTEPKDEPVPLEPTSEV 379 KPQP+ + EP+ EP P EP E+ Sbjct: 154 KPQPELVRDLEPEPEPEP-EPEPEI 177 >At3g46050.1 68416.m04983 kelch repeat-containing F-box family protein contains F-box domain Pfam:PF00646 and Kelch motif Pfam:PF01344 Length = 370 Score = 26.6 bits (56), Expect = 8.7 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +2 Query: 44 CTSCLLWCSPFHHGIWCP 97 C L+WC P WCP Sbjct: 248 CEGVLVWCEPEEDRGWCP 265 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,743,092 Number of Sequences: 28952 Number of extensions: 200350 Number of successful extensions: 552 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 821630280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -