Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_G17
         (653 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g17690.1 68415.m02048 F-box family protein contains F-box dom...    33   0.17 

>At2g17690.1 68415.m02048 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 421

 Score = 33.1 bits (72), Expect = 0.17
 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +2

Query: 467 GNANDSMIYLRSHLDKYLAVDSFGNVTCESEEKEPGSK--FHISVSDDNSGRW 619
           GN ND     ++H   ++  D+ GNV+C+  E++P     F +  +D+   +W
Sbjct: 296 GNGNDDFFAAQAHRFIHVLHDNLGNVSCKPFERDPPKTIGFKVYKNDEELLKW 348


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,985,053
Number of Sequences: 28952
Number of extensions: 248507
Number of successful extensions: 659
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 646
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 659
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1363910256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)