SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B18
         (656 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g01350.1 68414.m00050 zinc finger (CCCH-type/C3HC4-type RING ...    33   0.22 
At2g14130.1 68415.m01574 Ulp1 protease family protein contains P...    31   0.51 
At5g58370.2 68418.m07309 expressed protein                             30   1.2  
At5g58370.1 68418.m07308 expressed protein                             30   1.2  
At5g06420.2 68418.m00719 zinc finger (CCCH-type/C3HC4-type RING ...    30   1.6  
At5g06420.1 68418.m00718 zinc finger (CCCH-type/C3HC4-type RING ...    30   1.6  
At5g34900.1 68418.m04114 Ulp1 protease family protein contains P...    29   2.7  
At3g11720.1 68416.m01437 expressed protein                             29   3.6  
At2g20330.1 68415.m02374 transducin family protein / WD-40 repea...    29   3.6  
At1g19430.1 68414.m02421 dehydration-responsive protein-related ...    29   3.6  
At4g08430.1 68417.m01392 Ulp1 protease family protein similar to...    28   4.8  
At3g42190.1 68416.m04340 hypothetical protein                          28   4.8  
At3g16730.1 68416.m02136 expressed protein ; expression supporte...    28   4.8  
At1g17820.1 68414.m02206 expressed protein                             28   4.8  
At4g00310.1 68417.m00039 expressed protein                             28   6.3  
At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing ...    28   6.3  
At5g42400.1 68418.m05162 SET domain-containing protein (TXR7) co...    27   8.3  

>At1g01350.1 68414.m00050 zinc finger (CCCH-type/C3HC4-type RING
           finger) family protein similar to SP|O15541 Zinc finger
           protein 183 {Homo sapiens}; contains Pfam profiles
           PF04396: Protein of unknown function, DUF537, PF00097:
           Zinc finger, C3HC4 type (RING finger), PF00642: Zinc
           finger C-x8-C-x5-C-x3-H type (and similar)
          Length = 586

 Score = 32.7 bits (71), Expect = 0.22
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 3/55 (5%)
 Frame = +1

Query: 436 KRERQITPSPELKKASSDEEEVISL---PTKRKRIRLNPVDSDDSDVENKADNKI 591
           K  +Q  P P+     +  ++V +    PTK K IR   +D+D+ D ++K+++ I
Sbjct: 8   KPSQQEEPLPQPAAQETQSQQVCTFFKKPTKSKNIRKRTIDADEEDGDSKSESSI 62


>At2g14130.1 68415.m01574 Ulp1 protease family protein contains Pfam
           profile PF02902: Ulp1 protease family, C-terminal
           catalytic domain; similar to At1g32840, At4g04010,
           At2g06430, At2g15140, At2g04980, At3g44500, At2g15190,
           At3g47260, At5g34900, At3g29210, At2g02210, At3g32900
          Length = 808

 Score = 31.5 bits (68), Expect = 0.51
 Identities = 17/71 (23%), Positives = 36/71 (50%), Gaps = 3/71 (4%)
 Frame = +1

Query: 370 LKIPIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVIS---LPTKRKRIRLN 540
           + +  + +  K  K  +H E+  + R+  P    K+  S + +V +     +K+++I  N
Sbjct: 500 MSLSFMQLQNKRVKPSVHAEDNLKTRKQVPRKRQKQVDSADVDVPTRKEAKSKKRKIIGN 559

Query: 541 PVDSDDSDVEN 573
             D+DD+D +N
Sbjct: 560 DGDNDDNDGDN 570


>At5g58370.2 68418.m07309 expressed protein
          Length = 465

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 22/70 (31%), Positives = 35/70 (50%)
 Frame = +1

Query: 358 KRTLLKIPIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRL 537
           KR  L   + + PR+SS     + + K  +Q+     +    SD +E    P KRKRIRL
Sbjct: 116 KRDELDSNVDVSPRESSD----VPSFKARKQVFSEKRVVGDGSDVQE--DKPRKRKRIRL 169

Query: 538 NPVDSDDSDV 567
           +P D+ +  +
Sbjct: 170 DPYDTSNKRI 179


>At5g58370.1 68418.m07308 expressed protein
          Length = 446

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 22/70 (31%), Positives = 35/70 (50%)
 Frame = +1

Query: 358 KRTLLKIPIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRL 537
           KR  L   + + PR+SS     + + K  +Q+     +    SD +E    P KRKRIRL
Sbjct: 116 KRDELDSNVDVSPRESSD----VPSFKARKQVFSEKRVVGDGSDVQE--DKPRKRKRIRL 169

Query: 538 NPVDSDDSDV 567
           +P D+ +  +
Sbjct: 170 DPYDTSNKRI 179


>At5g06420.2 68418.m00719 zinc finger (CCCH-type/C3HC4-type RING
           finger) family protein contains Pfam domains PF00642:
           Zinc finger C-x8-C-x5-C-x3-H type (and similar) and
           PF00097: Zinc finger, C3HC4 type (RING finger)
          Length = 378

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 11/27 (40%), Positives = 19/27 (70%)
 Frame = +1

Query: 511 PTKRKRIRLNPVDSDDSDVENKADNKI 591
           PTK K IR   +D+D+ D ++K+++ I
Sbjct: 74  PTKSKNIRKRTIDADEEDGDSKSESSI 100


>At5g06420.1 68418.m00718 zinc finger (CCCH-type/C3HC4-type RING
           finger) family protein contains Pfam domains PF00642:
           Zinc finger C-x8-C-x5-C-x3-H type (and similar) and
           PF00097: Zinc finger, C3HC4 type (RING finger)
          Length = 378

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 11/27 (40%), Positives = 19/27 (70%)
 Frame = +1

Query: 511 PTKRKRIRLNPVDSDDSDVENKADNKI 591
           PTK K IR   +D+D+ D ++K+++ I
Sbjct: 74  PTKSKNIRKRTIDADEEDGDSKSESSI 100


>At5g34900.1 68418.m04114 Ulp1 protease family protein contains Pfam
           profile PF02902: Ulp1 protease family, C-terminal
           catalytic domain; similar to At1g32840, At4g04010,
           At2g06430, At2g15140, At2g04980, At2g14130, At3g44500,
           At2g15190, At3g47260, At3g29210, At2g02210, At3g32900
          Length = 767

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 14/62 (22%), Positives = 30/62 (48%)
 Frame = +1

Query: 400 KSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKA 579
           K  K  +H E+  + R+  P    K+  S +   + +PT+++  +   + +D  + +N  
Sbjct: 446 KRVKPSVHAEDNLKTRKQVPRKRQKQVDSAD---VDVPTRKESKKRKIIGNDGDNADNDD 502

Query: 580 DN 585
           DN
Sbjct: 503 DN 504


>At3g11720.1 68416.m01437 expressed protein
          Length = 542

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 18/61 (29%), Positives = 28/61 (45%)
 Frame = +1

Query: 403 SSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKAD 582
           SS      E+K  + +   SPE+K+A    E VIS+  K K    N   S + + E  + 
Sbjct: 373 SSSSSSEDEDKNGKTRFCISPEVKQALGTLERVISMVRKSKTDNNNTSTSSEEEEEEASS 432

Query: 583 N 585
           +
Sbjct: 433 S 433


>At2g20330.1 68415.m02374 transducin family protein / WD-40 repeat
           family protein similar to Transcriptional repressor
           rco-1 (SP:P78706) [Neurospora crassa]; similar to
           TUP1(GB:AF079369); contains 6 WD-40 repeats (PF00400)
          Length = 648

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 5/70 (7%)
 Frame = +1

Query: 394 PRKSSKKGIHLENKKRERQITPSPELK-----KASSDEEEVISLPTKRKRIRLNPVDSDD 558
           P  SSK+    E +  E  + P P  K       S DE ++I  P      R +  DSDD
Sbjct: 93  PPPSSKRTQEEEEEDEEVMMGPPPPPKGLGNINDSDDEGDMIGPPPPPPAARDSDEDSDD 152

Query: 559 SDVENKADNK 588
            D  +  +N+
Sbjct: 153 DDDNDNEENR 162


>At1g19430.1 68414.m02421 dehydration-responsive protein-related low
           similarity to early-responsive to dehydration stress
           ERD3 protein [Arabidopsis thaliana] GI:15320410;
           contains Pfam profile PF03141: Putative
           methyltransferase
          Length = 724

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 18/67 (26%), Positives = 29/67 (43%)
 Frame = +1

Query: 397 RKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENK 576
           +K     +H    K++++   S   KK    +  V  +  K  +      +SDDSD  NK
Sbjct: 97  KKVGGSSVHKHETKKKKEHAVSHPHKKKDVPKPVVEEVVVKEDQEH-EEAESDDSDQSNK 155

Query: 577 ADNKIGT 597
            D + GT
Sbjct: 156 EDGEEGT 162


>At4g08430.1 68417.m01392 Ulp1 protease family protein similar to
           At5g45570, At5g28235; contains Pfam profile PF02902:
           Ulp1 protease family, C-terminal catalytic domain
          Length = 808

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 1/62 (1%)
 Frame = +1

Query: 400 KSSKKGIHLENKKRERQITPSPELKKASSDEEEVIS-LPTKRKRIRLNPVDSDDSDVENK 576
           KS KK   +  +K E+   P PE+KK +   E+V S  P K+K +      + D DV + 
Sbjct: 377 KSDKKKTIVNVEKVEK---PKPEMKKTAVKVEKVDSPKPEKKKSVVAPTTKTFDDDVVDV 433

Query: 577 AD 582
            D
Sbjct: 434 TD 435


>At3g42190.1 68416.m04340 hypothetical protein
          Length = 695

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 1/45 (2%)
 Frame = +1

Query: 385 VMVPRKSSKKGIHLENKKRERQITPSPELKKASSDE-EEVISLPT 516
           +   + +S  G+HL N   ERQ+ P  +  KAS++  + VI   T
Sbjct: 467 IQCAQPTSGDGVHLSNVVEERQVCPVSDDGKASAENLDNVIKYGT 511


>At3g16730.1 68416.m02136 expressed protein ; expression supported
           by MPSS
          Length = 695

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 12/47 (25%), Positives = 24/47 (51%)
 Frame = +1

Query: 397 RKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRL 537
           RK+ K+GIHL  K+ +  IT     +     +    S+ ++ +++ L
Sbjct: 606 RKNEKRGIHLPQKRAKSPITKGKSHESPPPKKRNTCSVSSQTRKVSL 652


>At1g17820.1 68414.m02206 expressed protein
          Length = 803

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 15/43 (34%), Positives = 23/43 (53%)
 Frame = +1

Query: 370 LKIPIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEE 498
           LK P+ +VP  S+K+  +     RE     SP    ASS+E++
Sbjct: 717 LKTPL-LVPSSSNKQETNSRGSSREVSAVQSPSRSVASSEEDD 758


>At4g00310.1 68417.m00039 expressed protein
          Length = 302

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 11/33 (33%), Positives = 20/33 (60%)
 Frame = +1

Query: 436 KRERQITPSPELKKASSDEEEVISLPTKRKRIR 534
           K+   + P+  +K +  DE+ V+++PT  KR R
Sbjct: 143 KKSEALEPNSPVKTSGDDEKVVVTIPTAPKRGR 175


>At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing
           protein 
          Length = 987

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 17/63 (26%), Positives = 25/63 (39%)
 Frame = +1

Query: 394 PRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVEN 573
           PR   +  +    + R R +  S ++K  S DEE  +    KR R R     S   D   
Sbjct: 643 PRDDEENKVKRRTRSRSRSVEDSADIKDKSRDEE--LKHHKKRSRSRSREDRSKTRDTSR 700

Query: 574 KAD 582
            +D
Sbjct: 701 NSD 703


>At5g42400.1 68418.m05162 SET domain-containing protein (TXR7)
            contains Pfam profile PF00856: SET domain
          Length = 1423

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 13/49 (26%), Positives = 31/49 (63%)
 Frame = +1

Query: 436  KRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKAD 582
            ++ R+ + S  LK+    +E++ ++P++R R+ L+  DS+D+ ++   D
Sbjct: 1061 QKGRKSSQSSILKRKHQLDEKISNVPSRR-RLSLSSTDSEDAVIKEDYD 1108


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,125,203
Number of Sequences: 28952
Number of extensions: 204329
Number of successful extensions: 702
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 674
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 702
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1373722560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -