SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B17
         (629 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g27960.1 68415.m03389 cyclin-dependent kinase / CDK (CKS1) id...   118   4e-27
At2g27970.1 68415.m03390 cyclin-dependent kinase, putative / CDK...   116   2e-26
At4g05616.1 68417.m00870 hypothetical protein                          29   1.9  
At1g05520.1 68414.m00565 transport protein, putative similar to ...    29   2.5  
At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar...    29   3.4  
At1g13430.1 68414.m01568 sulfotransferase family protein similar...    29   3.4  

>At2g27960.1 68415.m03389 cyclin-dependent kinase / CDK (CKS1)
           identical to Cks1 protein [Arabidopsis thaliana]
           gi|2274859|emb|CAA03859
          Length = 87

 Score =  118 bits (283), Expect = 4e-27
 Identities = 44/68 (64%), Positives = 60/68 (88%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QIQYSE+Y DD +EYRHV+LPP++A+++PK+ L++E EWR +GVQQS GW+H+ VH PEP
Sbjct: 3   QIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAVHRPEP 62

Query: 302 HVLLFRRP 325
           H++LFRRP
Sbjct: 63  HIMLFRRP 70


>At2g27970.1 68415.m03390 cyclin-dependent kinase, putative / CDK,
           putative similar to Cks1 protein [Arabidopsis thaliana]
           gi|2274859|emb|CAA03859
          Length = 83

 Score =  116 bits (278), Expect = 2e-26
 Identities = 41/68 (60%), Positives = 61/68 (89%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QIQYS++Y DD +EYRHV+LPP++A+++PK+ +++E+EWR +GVQQS GW+H+ +H PEP
Sbjct: 3   QIQYSDKYFDDTFEYRHVVLPPEVAKLLPKNRILSESEWRAIGVQQSRGWVHYAIHRPEP 62

Query: 302 HVLLFRRP 325
           H++LFRRP
Sbjct: 63  HIMLFRRP 70


>At4g05616.1 68417.m00870 hypothetical protein
          Length = 346

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 4/52 (7%)
 Frame = +2

Query: 290 NPEPHVLLFRRPRTDIPAPLNGLDTNTSSAVKV*LFLLH----RHIFRCHSL 433
           +PE  +    RP  +  +P  GL+T + +  K+    LH    RH  RCHSL
Sbjct: 256 SPEHTITKPTRPEVEEESPTLGLNTASCTRAKLQYCELHKSYGRHTSRCHSL 307


>At1g05520.1 68414.m00565 transport protein, putative similar to
           Swiss-Prot:Q15436 protein transport protein Sec23A [Homo
           sapiens]
          Length = 783

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 2/44 (4%)
 Frame = +2

Query: 215 HLMTETEWRNLGVQQSPGWLHF--MVHNPEPHVLLFRRPRTDIP 340
           H MT  +WRNLG Q  P    F  ++  P+    +  R R  +P
Sbjct: 681 HGMTIAQWRNLGYQNQPEHQAFAQLLEAPQEDAQMIIRDRFPVP 724


>At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar to
           RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain, PF00397:
           WW domain
          Length = 713

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +2

Query: 236 WRNLGVQQSPGWLHFMVHNPEPHVLLFRRPRTDIPAPLNGLDTNTS 373
           W+ L V    G+L+F   NPE +V  + RP +  P  L  +  ++S
Sbjct: 21  WKGL-VDSRTGYLYFW--NPETNVTQYERPASSAPPKLAAIPVSSS 63


>At1g13430.1 68414.m01568 sulfotransferase family protein similar to
           steroid sulfotransferase 3 GI:3420008 from (Brassica
           napus); contains Pfam profile PF00685: Sulfotransferase
           domain
          Length = 351

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 23/90 (25%), Positives = 38/90 (42%)
 Frame = +2

Query: 302 HVLLFRRPRTDIPAPLNGLDTNTSSAVKV*LFLLHRHIFRCHSLILFKLLIETIIVKTKK 481
           H LL   P   +P     L  N SS   +  FL          L    + ++ + +  KK
Sbjct: 106 HPLLSHNPHEIVPYLELDLYLN-SSKPDLTKFLSSSSSSSSPRLFSTHMSLDALKLPLKK 164

Query: 482 KNCSIYYKLADINYYYITLFCLSLNSNRGV 571
             C + Y   ++    ++L+C  LN+N+GV
Sbjct: 165 SPCKVVYVCRNVKDVLVSLWCF-LNANKGV 193


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,281,456
Number of Sequences: 28952
Number of extensions: 248669
Number of successful extensions: 622
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 612
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 622
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1285411824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -