SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B16
         (656 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g60380.1 68416.m06753 expressed protein                             31   0.67 
At4g01510.1 68417.m00194 transmembrane ARV1-like family protein ...    30   1.2  
At1g27170.1 68414.m03310 disease resistance protein (TIR-NBS-LRR...    30   1.6  
At3g46180.1 68416.m04997 UDP-galactose/UDP-glucose transporter-r...    29   2.1  
At5g59740.1 68418.m07488 UDP-galactose/UDP-glucose transporter-r...    28   4.8  
At1g01020.1 68414.m00002 transmembrane ARV1-like family protein ...    28   4.8  
At5g08550.1 68418.m01017 expressed protein                             28   6.3  
At1g13420.1 68414.m01566 sulfotransferase family protein similar...    28   6.3  
At5g66610.1 68418.m08396 LIM domain-containing protein contains ...    27   8.3  
At5g11650.1 68418.m01362 hydrolase, alpha/beta fold family prote...    27   8.3  
At1g13630.1 68414.m01601 pentatricopeptide (PPR) repeat-containi...    27   8.3  

>At3g60380.1 68416.m06753 expressed protein 
          Length = 743

 Score = 31.1 bits (67), Expect = 0.67
 Identities = 16/52 (30%), Positives = 28/52 (53%)
 Frame = +3

Query: 111 SCENRHSTEQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAAPYYIRKQEP 266
           S E+R   + + R    +R P  EEL++ L Q+   + RA++ P  +  +EP
Sbjct: 621 SSEDRAEAKVESRGRTKSRRPRQEELSIVLHQEKSSETRAKSEPEEVAMEEP 672


>At4g01510.1 68417.m00194 transmembrane ARV1-like family protein
           contains similarity to ARV1 [Homo sapiens]
           gi|12044055|gb|AAG47671
          Length = 252

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 5/92 (5%)
 Frame = +3

Query: 321 RRLKEKKQPCHEIS--VDS*FINKT---FYL*KCGTCCEIACVYETCRITMVLYAESVRE 485
           R +  +K+ C E    V S FI  +   F L KC  C E+A  Y  C + ++++ + +  
Sbjct: 23  REMAREKKTCVECGHKVKSLFIQYSPGNFRLMKCENCEEVADEYVECEL-LIIFIDLILH 81

Query: 486 KDGYL*RVLRDTSHENELKWPHVLYNLQS*YL 581
           K      +L +  ++      H+L+ L   YL
Sbjct: 82  KTKAYRHLLYNVVNQESANVQHLLWKLVLAYL 113


>At1g27170.1 68414.m03310 disease resistance protein (TIR-NBS-LRR
           class), putative domain signature TIR-NBS-LRR exists,
           suggestive of a disease resistance protein.
          Length = 1544

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +3

Query: 66  NFKIKTFTTMLREKSSCENRHSTEQDRRQLPSNRL-PPIEELTLGLKQ 206
           NF+ + F + +RE+SS EN   T Q        RL P IE++++GL++
Sbjct: 398 NFEQRAFISDIRERSSAENGLVTLQKTLIKELFRLVPEIEDVSIGLEK 445


>At3g46180.1 68416.m04997 UDP-galactose/UDP-glucose
           transporter-related contains weak similarity to
           UDP-galactose/UDP-glucose transporter (GI:22651763)
           [Arabidopsis thaliana]
          Length = 347

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 3/48 (6%)
 Frame = -3

Query: 423 FHNMFHTFTDRMFC---L*IKNLQIFHDTVVSFLLIFEQLQQQGHVAP 289
           F     TF D++F    + I N QIF+ T+ S +L F  L  QGH+ P
Sbjct: 190 FDGFTSTFQDKLFKGYNMEIHN-QIFYTTICSSILSFTGLILQGHLLP 236


>At5g59740.1 68418.m07488 UDP-galactose/UDP-glucose
           transporter-related weak similarity to
           UDP-galactose/UDP-glucose transporter [Arabidopsis
           thaliana] GI:22651763
          Length = 344

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 3/48 (6%)
 Frame = -3

Query: 423 FHNMFHTFTDRMFC---L*IKNLQIFHDTVVSFLLIFEQLQQQGHVAP 289
           F     TF D++F    + I N QIF+ T+ S +L F  L  QGH+ P
Sbjct: 189 FDGFTSTFQDKLFKGYNMEIHN-QIFYTTLCSCVLSFTGLILQGHLLP 235


>At1g01020.1 68414.m00002 transmembrane ARV1-like family protein
           contains similarity to ARV1 [Homo sapiens]
           gi|12044055|gb|AAG47671
          Length = 128

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 16/60 (26%), Positives = 28/60 (46%)
 Frame = +3

Query: 402 KCGTCCEIACVYETCRITMVLYAESVREKDGYL*RVLRDTSHENELKWPHVLYNLQS*YL 581
           KCG C E+A  Y  C   M+++ + +  +      VL +  +   +   H+L+ L   YL
Sbjct: 31  KCGNCKEVADEYIECE-RMIIFIDLILHRPKVYRHVLYNAINPATVNIQHLLWKLVFAYL 89


>At5g08550.1 68418.m01017 expressed protein
          Length = 908

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/46 (34%), Positives = 23/46 (50%)
 Frame = +3

Query: 108 SSCENRHSTEQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAAPY 245
           S   +RHS+ ++RR   SN LP  +  +   +  L LQ   R  PY
Sbjct: 89  SGSSHRHSSTKERRPASSNVLP--QAGSYSKEALLELQKNTRTLPY 132


>At1g13420.1 68414.m01566 sulfotransferase family protein similar to
           steroid sulfotransferase 1 GI:3420004 from (Brassica
           napus); contains Pfam profile PF00685: Sulfotransferase
           domain
          Length = 331

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 8/17 (47%), Positives = 13/17 (76%)
 Frame = -3

Query: 516 RARHVTDSHPFLARSPH 466
           R++H +D+HP L  +PH
Sbjct: 96  RSKHTSDNHPLLTHNPH 112


>At5g66610.1 68418.m08396 LIM domain-containing protein contains
           Pfam profile PF00412: LIM domain
          Length = 529

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 3/46 (6%)
 Frame = +1

Query: 370 LNL*TKHSICESVEHVVKSLVCMKRVGLQW---CYMRRACEKRMAI 498
           LN+   HSIC+  +  ++    +  +G+ W   C+  R C+K +A+
Sbjct: 192 LNVNHPHSICDGCKSAIEYGRSVHALGVNWHPECFCCRYCDKPIAM 237


>At5g11650.1 68418.m01362 hydrolase, alpha/beta fold family protein
           contains Pfam profile PF00561: hydrolase, alpha/beta
           fold family; low similarity to monoglyceride lipase from
           [Homo sapiens] GI:14594904, [Mus musculus] GI:2632162
          Length = 390

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 12/40 (30%), Positives = 25/40 (62%)
 Frame = -3

Query: 375 IKNLQIFHDTVVSFLLIFEQLQQQGHVAPITFPRDQLVPA 256
           ++   +F  ++V  LL+  +L+ +  V+P++ P D+ VPA
Sbjct: 26  LRKCLVFVLSLVLSLLLILRLRPRRRVSPLSSPEDEAVPA 65


>At1g13630.1 68414.m01601 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile: PF01535 PPR repeat
          Length = 764

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 9/34 (26%), Positives = 22/34 (64%)
 Frame = +3

Query: 75  IKTFTTMLREKSSCENRHSTEQDRRQLPSNRLPP 176
           + ++TT++   ++C N  S ++ RR++ +  +PP
Sbjct: 518 VVSYTTLMDAYANCGNTKSIDELRREMKAEGIPP 551


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,353,222
Number of Sequences: 28952
Number of extensions: 257073
Number of successful extensions: 662
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 651
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 662
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1373722560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -