SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B15
         (511 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g47370.2 68416.m05151 40S ribosomal protein S20 (RPS20B) 40S ...    93   1e-19
At3g47370.1 68416.m05150 40S ribosomal protein S20 (RPS20B) 40S ...    93   1e-19
At5g62300.1 68418.m07821 40S ribosomal protein S20 (RPS20C) ribo...    91   5e-19
At3g45030.1 68416.m04851 40S ribosomal protein S20 (RPS20A) 40S ...    91   5e-19
At3g13120.1 68416.m01642 30S ribosomal protein S10, chloroplast,...    39   0.002
At3g62070.1 68416.m06974 expressed protein hypothetical protein ...    27   5.5  
At3g13150.1 68416.m01645 pentatricopeptide (PPR) repeat-containi...    27   5.5  
At3g18310.1 68416.m02330 expressed protein                             27   7.3  
At5g47370.1 68418.m05838 homeobox-leucine zipper protein 2 (HAT2...    27   9.7  
At5g27220.1 68418.m03247 protein transport protein-related low s...    27   9.7  
At1g80330.1 68414.m09404 gibberellin 3-beta-dioxygenase, putativ...    27   9.7  
At1g12220.1 68414.m01414 disease resistance protein RPS5 (CC-NBS...    27   9.7  

>At3g47370.2 68416.m05151 40S ribosomal protein S20 (RPS20B) 40S
           RIBOSOMAL PROTEIN S20 - ARABIDOPSIS
           THALIANA,PID:g1350956
          Length = 122

 Score = 92.7 bits (220), Expect = 1e-19
 Identities = 40/59 (67%), Positives = 52/59 (88%)
 Frame = +1

Query: 151 QAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           +A +  IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTRK P
Sbjct: 14  EAPLEQIHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAP 72



 Score = 84.6 bits (200), Expect = 3e-17
 Identities = 37/49 (75%), Positives = 44/49 (89%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 478
           GEG+ TWDRF++R+HKRVIDL S  ++VKQITSI IEPGVEVEVTIAD+
Sbjct: 74  GEGTNTWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122


>At3g47370.1 68416.m05150 40S ribosomal protein S20 (RPS20B) 40S
           RIBOSOMAL PROTEIN S20 - ARABIDOPSIS
           THALIANA,PID:g1350956
          Length = 122

 Score = 92.7 bits (220), Expect = 1e-19
 Identities = 40/59 (67%), Positives = 52/59 (88%)
 Frame = +1

Query: 151 QAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           +A +  IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTRK P
Sbjct: 14  EAPLEQIHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAP 72



 Score = 84.6 bits (200), Expect = 3e-17
 Identities = 37/49 (75%), Positives = 44/49 (89%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 478
           GEG+ TWDRF++R+HKRVIDL S  ++VKQITSI IEPGVEVEVTIAD+
Sbjct: 74  GEGTNTWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122


>At5g62300.1 68418.m07821 40S ribosomal protein S20 (RPS20C)
           ribosomal protein S20, Arabidopsis thaliana, PIR:T12992
          Length = 124

 Score = 90.6 bits (215), Expect = 5e-19
 Identities = 39/53 (73%), Positives = 49/53 (92%)
 Frame = +1

Query: 169 IHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTRK P
Sbjct: 22  IHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAP 74



 Score = 84.6 bits (200), Expect = 3e-17
 Identities = 37/49 (75%), Positives = 44/49 (89%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 478
           GEG+ TWDRF++R+HKRVIDL S  ++VKQITSI IEPGVEVEVTIAD+
Sbjct: 76  GEGTNTWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 124


>At3g45030.1 68416.m04851 40S ribosomal protein S20 (RPS20A) 40S
           ribsomomal proteinS20, Arabidopsis thaliana, pir:T12992
          Length = 124

 Score = 90.6 bits (215), Expect = 5e-19
 Identities = 39/53 (73%), Positives = 49/53 (92%)
 Frame = +1

Query: 169 IHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTRK P
Sbjct: 22  IHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAP 74



 Score = 84.6 bits (200), Expect = 3e-17
 Identities = 37/49 (75%), Positives = 44/49 (89%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 478
           GEG+ TWDRF++R+HKRVIDL S  ++VKQITSI IEPGVEVEVTIAD+
Sbjct: 76  GEGTNTWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 124


>At3g13120.1 68416.m01642 30S ribosomal protein S10, chloroplast,
           putative similar to 30S ribosomal protein S10 GB:P02364
           [Escherichia coli] (est matches suggest the N-terminal
           extension)
          Length = 191

 Score = 39.1 bits (87), Expect = 0.002
 Identities = 22/72 (30%), Positives = 35/72 (48%)
 Frame = +1

Query: 112 AAAVVSGKDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMP 291
           A+ V S   I     +++P  +IRI L S  V  +E  C  +++ A+    +  GPV +P
Sbjct: 73  ASEVPSSSSISVDADKMAPKQKIRIKLRSYWVPLIEDSCKQILDAARNTNAKTMGPVPLP 132

Query: 292 TKILRITTRKTP 327
           TK       K+P
Sbjct: 133 TKKRIYCVLKSP 144



 Score = 30.3 bits (65), Expect = 0.79
 Identities = 12/38 (31%), Positives = 26/38 (68%), Gaps = 1/38 (2%)
 Frame = +2

Query: 359 FQMRIHKRVID-LHSPSEIVKQITSINIEPGVEVEVTI 469
           F++R H+R+ID L+  ++ +  +  +++  GV+VEV +
Sbjct: 154 FEIRTHQRMIDILYPTAQTIDSLMQLDLPAGVDVEVKL 191


>At3g62070.1 68416.m06974 expressed protein hypothetical protein
           F14M4.23 - Arabidopsis thaliana, PIR:T02193
          Length = 228

 Score = 27.5 bits (58), Expect = 5.5
 Identities = 15/50 (30%), Positives = 27/50 (54%)
 Frame = +3

Query: 15  KSYLKREVSPVQR*TIFDLKSCLSRPEFNKQHGSRCSVRQRHRETPGRGL 164
           + +    V+P +R     +   L   E NK +GS+CS+R++ RE   +G+
Sbjct: 73  RGFYSLPVTPSRRRRKLTVSGELDANESNK-NGSKCSLRRQRREKKKKGV 121


>At3g13150.1 68416.m01645 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 551

 Score = 27.5 bits (58), Expect = 5.5
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +2

Query: 83  ISAGIQQATWQPL*CQAKTSRNPRQRSPLFTASGSLLLLAMCAHSRRS 226
           +SAG ++ T  P+   AKT+  P   SP    S  LL L++ A S  S
Sbjct: 406 LSAGKKKTTSSPVSSSAKTTSTPVSSSP--DTSSFLLSLSLAADSSSS 451


>At3g18310.1 68416.m02330 expressed protein
          Length = 873

 Score = 27.1 bits (57), Expect = 7.3
 Identities = 8/21 (38%), Positives = 14/21 (66%)
 Frame = +3

Query: 243 WSQETEAACKGPSPHANQDPA 305
           W+ +++  C GPSP   +DP+
Sbjct: 400 WNAQSQMFCFGPSPSVGKDPS 420


>At5g47370.1 68418.m05838 homeobox-leucine zipper protein 2 (HAT2) /
           HD-ZIP protein 2 identical to homeobox-leucine zipper
           protein HAT2 (HD-ZIP protein 2) [Arabidopsis thaliana]
           SP:P46601; contains Pfam profiles PF04618: HD-ZIP
           protein N terminus, PF02183: Homeobox associated leucine
           zipper,  PF00046: Homeobox domain
          Length = 283

 Score = 26.6 bits (56), Expect = 9.7
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = -3

Query: 404 RESVGRSLSCGFASENDPRSLNLH 333
           +E +G SLS GF+  ++P  +NL+
Sbjct: 5   KEDLGLSLSLGFSQNHNPLQMNLN 28


>At5g27220.1 68418.m03247 protein transport protein-related low
           similarity to SP|P25386 Intracellular protein transport
           protein USO1 {Saccharomyces cerevisiae}
          Length = 1181

 Score = 26.6 bits (56), Expect = 9.7
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 204 IARSKSDPDAVNRGDLCL 151
           +A +K DPD+V RG +CL
Sbjct: 698 MAVTKLDPDSVRRGSICL 715


>At1g80330.1 68414.m09404 gibberellin 3-beta-dioxygenase, putative /
           gibberellin 3 beta-hydroxylase, putative similar to
           gibberellin 3 beta-hydroxylase GA4H GB:AAC83647
           [Arabidopsis thaliana], GA4 [GI:2160454]
          Length = 355

 Score = 26.6 bits (56), Expect = 9.7
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = +2

Query: 308 SPPVKLLGGEGSKTWDRFQMRIH 376
           +P V  L G+ SKTW  FQ+  H
Sbjct: 56  NPDVTTLIGDASKTWGAFQIANH 78


>At1g12220.1 68414.m01414 disease resistance protein RPS5
           (CC-NBS-LRR class) / resistance to Pseudomonas syringae
           protein 5 (CC-NBS-LRR class) domain signature CC-NBS-LRR
           exists, suggestive of a disease resistance protein.
           Identical to RPS5 (resistance to Pseudomonas syringae
           protein 5)(gi:3309620)
          Length = 889

 Score = 26.6 bits (56), Expect = 9.7
 Identities = 12/42 (28%), Positives = 23/42 (54%)
 Frame = +2

Query: 272 RAQSACQPRSCVSPPVKLLGGEGSKTWDRFQMRIHKRVIDLH 397
           R++  C  R  V  P+++   +  ++WD FQM++ K  +  H
Sbjct: 294 RSRDVCG-RMGVDDPMEVSCLQPEESWDLFQMKVGKNTLGSH 334


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,450,061
Number of Sequences: 28952
Number of extensions: 246154
Number of successful extensions: 576
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 561
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 576
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 917929344
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -