SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B14
         (558 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g41520.1 68418.m05044 40S ribosomal protein S10 (RPS10B) cont...   143   6e-35
At4g25740.1 68417.m03706 40S ribosomal protein S10 (RPS10A) 40S ...   141   3e-34
At5g52650.1 68418.m06536 40S ribosomal protein S10 (RPS10C) cont...   134   3e-32
At1g01010.1 68414.m00001 no apical meristem (NAM) family protein...    28   3.7  
At5g36210.1 68418.m04365 expressed protein                             27   6.4  
At5g34930.1 68418.m04119 arogenate dehydrogenase identical to ar...    27   8.5  

>At5g41520.1 68418.m05044 40S ribosomal protein S10 (RPS10B)
           contains similarity to 40S ribosomal protein S10
          Length = 180

 Score =  143 bits (347), Expect = 6e-35
 Identities = 78/163 (47%), Positives = 101/163 (61%), Gaps = 6/163 (3%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           M++ + NR  I +YLFKEGV+ AKKD++ P+H  +E +PNLQVIK MQS KS+ YV+E F
Sbjct: 1   MIISETNRREISKYLFKEGVLFAKKDFNLPQHPLIESVPNLQVIKLMQSFKSKEYVRETF 60

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVG-RPDAPARS---- 400
           AW H+YW+LTNEGI++LR +L+LP EIVPATLK+  +      G  G RP  P R     
Sbjct: 61  AWMHYYWFLTNEGIDFLRTYLNLPSEIVPATLKKQQKPLGRPFGGGGDRPRGPPRGDGER 120

Query: 401 -AEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRGR 526
              DR  YR  P + G   +  KA   P      F+GG G  R
Sbjct: 121 RFGDRDGYRGGPKSGG--EYGDKAG-APADYQPGFRGGAGGAR 160


>At4g25740.1 68417.m03706 40S ribosomal protein S10 (RPS10A) 40S
           ribosomal protein S10 - Lumbricus rubellus, PID:e1329701
          Length = 177

 Score =  141 bits (341), Expect = 3e-34
 Identities = 77/158 (48%), Positives = 100/158 (63%), Gaps = 3/158 (1%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           M++ + NR  I +YLFKEGV  AKKD++ PKH  ++ +PNLQVIK MQS KS+ YV+E F
Sbjct: 1   MIISENNRREICKYLFKEGVCFAKKDFNLPKHPLID-VPNLQVIKLMQSFKSKEYVRETF 59

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRT-ETVRRGPVG-RPDAPARSAED 409
           AW H+YW+LTNEGIE+LR +L+LP ++VPATLK+S +       GP G R   P RS  D
Sbjct: 60  AWMHYYWFLTNEGIEFLRTYLNLPSDVVPATLKKSAKPGGRPFGGPPGDRQRGPPRSDGD 119

Query: 410 RSAY-RRTPAAPGVAPHDKKADVGPGSADLEFKGGYGR 520
           R  +  R     G    D+K    P      F+GG GR
Sbjct: 120 RPRFGDRDGYRGGPRGGDEKGG-APADFQPSFQGGGGR 156


>At5g52650.1 68418.m06536 40S ribosomal protein S10 (RPS10C)
           contains similarity to 40S ribosomal protein S10
          Length = 179

 Score =  134 bits (325), Expect = 3e-32
 Identities = 77/167 (46%), Positives = 100/167 (59%), Gaps = 11/167 (6%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           M++ + NR  I +YLFKEGV  AKKD++  KH  ++ +PNLQVIK MQS KS+ YV+E F
Sbjct: 1   MIISEANRKEICKYLFKEGVCFAKKDFNLAKHPLID-VPNLQVIKLMQSFKSKEYVRETF 59

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRT-ETVRRGPVG-RPDAPARSA-- 403
           AW H+YW+LTNEGIE+LR +L+LP ++VPATLK+S +       GP G R   P      
Sbjct: 60  AWMHYYWFLTNEGIEFLRTYLNLPSDVVPATLKKSAKPGGRPFGGPPGDRSRGPRHEGGD 119

Query: 404 ----EDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKG---GYGRG 523
                DR  YR  P A G    +K     P      F+G   G+GRG
Sbjct: 120 RPRFGDRDGYRAGPRAGGEFGGEKGG--APADYQPSFQGSGRGFGRG 164


>At1g01010.1 68414.m00001 no apical meristem (NAM) family protein
           contains Pfam PF02365: No apical meristem (NAM) domain;
           similar to NAC domain protein NAM GB: AAD17313
           GI:4325282 from [Arabidopsis thaliana]
          Length = 429

 Score = 28.3 bits (60), Expect = 3.7
 Identities = 10/30 (33%), Positives = 20/30 (66%)
 Frame = +2

Query: 143 PKHTELEKIPNLQVIKAMQSLKSRGYVKEQ 232
           P HT ++ IP+L +I+ + + K++   K+Q
Sbjct: 333 PGHTRIDDIPSLNIIEPLHNYKAQEQPKQQ 362


>At5g36210.1 68418.m04365 expressed protein
          Length = 676

 Score = 27.5 bits (58), Expect = 6.4
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +2

Query: 53  KMLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKH 151
           K++ P Q+R  IYE L K+G+ VA  +Y   +H
Sbjct: 603 KVVTPDQSR-KIYEALKKKGLPVALVEYEGEQH 634


>At5g34930.1 68418.m04119 arogenate dehydrogenase identical to
           arogenate dehydrogenase GI:16903098 from [Arabidopsis
           thaliana]; contains Pfam profile: PF02153: prephenate
           dehydrogenase
          Length = 640

 Score = 27.1 bits (57), Expect = 8.5
 Identities = 11/29 (37%), Positives = 16/29 (55%)
 Frame = -3

Query: 148 LRCMIVFFGHHDSLFKEVLINSNTVLFGH 62
           LR  I+ FG++     E LI+   +LF H
Sbjct: 53  LRIAIIGFGNYGQFLAETLISQGHILFAH 81


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,506,393
Number of Sequences: 28952
Number of extensions: 224991
Number of successful extensions: 609
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 591
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 607
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1062855648
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -