SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B12
         (402 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g52300.1 68414.m05901 60S ribosomal protein L37 (RPL37B) simi...   101   2e-22
At3g16080.1 68416.m02032 60S ribosomal protein L37 (RPL37C) simi...   100   3e-22
At1g15250.1 68414.m01825 60S ribosomal protein L37 (RPL37A) almo...   100   7e-22
At2g05330.1 68415.m00561 speckle-type POZ protein-related contai...    29   1.5  
At4g00450.1 68417.m00062 expressed protein                             27   6.2  
At1g74760.1 68414.m08662 zinc finger (C3HC4-type RING finger) fa...    27   6.2  
At3g62150.1 68416.m06983 multidrug resistant (MDR) ABC transport...    24   6.4  
At1g62220.1 68414.m07018 expressed protein                             26   8.2  
At1g55255.1 68414.m06311 zinc finger (C3HC4-type RING finger) fa...    26   8.2  

>At1g52300.1 68414.m05901 60S ribosomal protein L37 (RPL37B) similar
           to SP:Q43292 from [Arabidopsis thaliana]
          Length = 95

 Score =  101 bits (242), Expect = 2e-22
 Identities = 46/82 (56%), Positives = 58/82 (70%), Gaps = 1/82 (1%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NK+HTLC RCGR S+HIQKS+C+ C YPAA+ R+Y+WSVKA          MR+L+ V R
Sbjct: 13  NKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRNVPR 72

Query: 248 RFRNGFKEGKPTPPK-KAVASS 310
           RF+ GF+EG    P+ K VASS
Sbjct: 73  RFKTGFREGTEAKPRNKGVASS 94


>At3g16080.1 68416.m02032 60S ribosomal protein L37 (RPL37C) similar
           to ribosomal protein L37 GB:BAA04888 from [Homo sapiens]
          Length = 95

 Score =  100 bits (240), Expect = 3e-22
 Identities = 46/82 (56%), Positives = 58/82 (70%), Gaps = 1/82 (1%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NK+HTLC RCGR S+HIQKS+C+ C YPAA+ R+Y+WSVKA          MR+L+ V R
Sbjct: 13  NKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRNVPR 72

Query: 248 RFRNGFKEGKPTPPK-KAVASS 310
           RF+ GF+EG    P+ KA ASS
Sbjct: 73  RFKTGFREGTEAKPRSKASASS 94


>At1g15250.1 68414.m01825 60S ribosomal protein L37 (RPL37A) almost
           identical to GB:Q43292
          Length = 95

 Score = 99.5 bits (237), Expect = 7e-22
 Identities = 46/82 (56%), Positives = 58/82 (70%), Gaps = 1/82 (1%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NK+HTLC RCGR S+HIQKS+C+ C YPAA+ R+Y+WSVKA          MR+L+ V R
Sbjct: 13  NKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRNVPR 72

Query: 248 RFRNGFKEG-KPTPPKKAVASS 310
           RF+  F+EG + TP  KA ASS
Sbjct: 73  RFKTCFREGTQATPRNKAAASS 94


>At2g05330.1 68415.m00561 speckle-type POZ protein-related contains
           Pfam PF00651 : BTB/POZ domain
          Length = 215

 Score = 28.7 bits (61), Expect = 1.5
 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 1/24 (4%)
 Frame = +2

Query: 80  TLCRRCGRSSYHIQK-SKCAQCGY 148
           T C RCG  +YH Q  + C  CG+
Sbjct: 186 TSCSRCGLITYHNQTGTSCCSCGF 209


>At4g00450.1 68417.m00062 expressed protein
          Length = 2124

 Score = 26.6 bits (56), Expect = 6.2
 Identities = 12/34 (35%), Positives = 16/34 (47%)
 Frame = +2

Query: 86  CRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVK 187
           CRR  R   + +KS C Q   P A     +W +K
Sbjct: 788 CRRAKRPKMNDEKSSCYQGNSPIASDEEDNWWIK 821


>At1g74760.1 68414.m08662 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam domain PF00097: Zinc
           finger, C3HC4 type (RING finger)
          Length = 255

 Score = 26.6 bits (56), Expect = 6.2
 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 4/30 (13%)
 Frame = +2

Query: 68  NKTHT-LCRRCGRSS---YHIQKSKCAQCG 145
           NKT   LC  CGR     YH    KC  CG
Sbjct: 219 NKTQVILCNDCGRKGNAPYHWLYHKCTTCG 248


>At3g62150.1 68416.m06983 multidrug resistant (MDR) ABC transporter,
            putative similar to multidrug-resistant protein CjMDR1
            GI:14715462 from [Coptis japonica]; contains Pfam
            profiles PF00005: ABC transporter, PF00664: ABC
            transporter transmembrane region
          Length = 1292

 Score = 24.2 bits (50), Expect(2) = 6.4
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +3

Query: 93   DVVDRHITFKNQNAPNVDILQ 155
            D+  RHI+FK  + P+V I Q
Sbjct: 1047 DIELRHISFKYPSRPDVQIFQ 1067



 Score = 20.6 bits (41), Expect(2) = 6.4
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = +3

Query: 141  VDILQQNYDPTTGQ 182
            + +LQ+ YDP +GQ
Sbjct: 1093 IALLQRFYDPDSGQ 1106


>At1g62220.1 68414.m07018 expressed protein
          Length = 153

 Score = 26.2 bits (55), Expect = 8.2
 Identities = 16/67 (23%), Positives = 27/67 (40%)
 Frame = +3

Query: 87  AEDVVDRHITFKNQNAPNVDILQQNYDPTTGQ*RLSAGRLLELAACVI*RLSGGASVMVL 266
           + DV      F N   P+ +  +  Y  T+GQ  ++ GR   +++       G A   V 
Sbjct: 58  SSDVYSSATGFNNPKGPDANAYENGYTSTSGQ-VIAKGRKARVSSASASTAKGDAKAAVT 116

Query: 267 KKGNQRR 287
           +K    R
Sbjct: 117 RKAAAAR 123


>At1g55255.1 68414.m06311 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 383

 Score = 26.2 bits (55), Expect = 8.2
 Identities = 9/23 (39%), Positives = 13/23 (56%)
 Frame = +2

Query: 77  HTLCRRCGRSSYHIQKSKCAQCG 145
           H  C++C + S  I+  KC  CG
Sbjct: 348 HLFCQQCIQRSLEIRHRKCPGCG 370


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,164,437
Number of Sequences: 28952
Number of extensions: 131413
Number of successful extensions: 279
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 278
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 279
length of database: 12,070,560
effective HSP length: 74
effective length of database: 9,928,112
effective search space used: 585758608
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -