SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B11
         (654 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g23410.1 68414.m02932 ubiquitin extension protein, putative /...   206   8e-54
At2g47110.1 68415.m05883 ubiquitin extension protein 6 (UBQ6) / ...   204   3e-53
At3g62250.1 68416.m06993 ubiquitin extension protein 5 (UBQ5) / ...   204   4e-53
At5g20620.1 68418.m02449 polyubiquitin (UBQ4) identical to GI:17677   135   2e-32
At5g03240.2 68418.m00273 polyubiquitin (UBQ3) identical to GI:92...   135   2e-32
At5g03240.1 68418.m00272 polyubiquitin (UBQ3) identical to GI:92...   135   2e-32
At4g05320.5 68417.m00814 polyubiquitin (UBQ10) (SEN3) senescence...   135   2e-32
At4g05320.4 68417.m00813 polyubiquitin (UBQ10) (SEN3) senescence...   135   2e-32
At4g05320.3 68417.m00812 polyubiquitin (UBQ10) (SEN3) senescence...   135   2e-32
At4g05320.2 68417.m00811 polyubiquitin (UBQ10) (SEN3) senescence...   135   2e-32
At4g05320.1 68417.m00810 polyubiquitin (UBQ10) (SEN3) senescence...   135   2e-32
At4g05050.1 68417.m00744 polyubiquitin (UBQ11) identical to GI:3...   135   2e-32
At4g02890.3 68417.m00391 polyubiquitin (UBQ14) identical to GI:1...   135   2e-32
At4g02890.2 68417.m00390 polyubiquitin (UBQ14) identical to GI:1...   135   2e-32
At4g02890.1 68417.m00389 polyubiquitin (UBQ14) identical to GI:1...   135   2e-32
At3g52590.1 68416.m05792 ubiquitin extension protein 1 (UBQ1) / ...   135   2e-32
At2g36170.1 68415.m04439 ubiquitin extension protein 2 (UBQ2) / ...   135   2e-32
At2g35635.1 68415.m04370 ubiquitin family protein contains INTER...   135   2e-32
At1g65350.1 68414.m07413 polyubiquitin, putative similar to poly...   135   2e-32
At1g31340.1 68414.m03835 ubiquitin family protein contains INTER...   135   2e-32
At1g55060.1 68414.m06289 polyubiquitin (UBQ12) identical to poly...   134   5e-32
At5g37640.1 68418.m04533 polyubiquitin (UBQ9) identical to polyu...   134   6e-32
At3g09790.1 68416.m01163 polyubiquitin (UBQ8) identical to polyu...   128   4e-30
At1g53930.1 68414.m06139 ubiquitin family protein contains Pfam ...   109   2e-24
At1g11980.1 68414.m01384 ubiquitin family protein similar to Cha...    83   1e-16
At1g53950.1 68414.m06145 ubiquitin family protein contains INTER...    65   3e-11
At5g42220.1 68418.m05139 ubiquitin family protein contains INTER...    63   2e-10
At4g12570.1 68417.m01983 ubiquitin-protein ligase, putative simi...    59   2e-09
At5g38470.1 68418.m04650 DNA repair protein RAD23, putative simi...    53   2e-07
At2g17190.1 68415.m01985 ubiquitin family protein contains INTER...    51   6e-07
At4g02970.1 68417.m00404 ubiquitin family protein contains INTER...    50   1e-06
At2g17200.1 68415.m01986 ubiquitin family protein weak similarit...    50   1e-06
At4g03350.1 68417.m00457 ubiquitin family protein contains INTER...    48   7e-06
At3g02540.2 68416.m00243 ubiquitin family protein contains Pfam ...    48   7e-06
At3g02540.1 68416.m00242 ubiquitin family protein contains Pfam ...    48   7e-06
At3g13235.1 68416.m01666 ubiquitin family protein contains INTER...    47   1e-05
At4g03370.1 68417.m00459 ubiquitin family protein contains INTER...    46   2e-05
At1g79650.3 68414.m09289 DNA repair protein RAD23, putative simi...    46   2e-05
At1g79650.2 68414.m09288 DNA repair protein RAD23, putative simi...    46   2e-05
At1g79650.1 68414.m09287 DNA repair protein RAD23, putative simi...    46   2e-05
At1g16190.1 68414.m01939 DNA repair protein RAD23, putative simi...    46   2e-05
At1g32750.1 68414.m04038 HAC13 protein (HAC13) identical to HAC1...    46   3e-05
At5g09340.1 68418.m01082 ubiquitin, putative similar to ubiquiti...    44   7e-05
At4g01000.1 68417.m00135 ubiquitin family protein low similarity...    43   2e-04
At3g19040.1 68416.m02418 ubiquitin family protein / DNA-binding ...    43   2e-04
At2g46500.2 68415.m05791 phosphatidylinositol 3- and 4-kinase fa...    43   2e-04
At2g46500.1 68415.m05790 phosphatidylinositol 3- and 4-kinase fa...    43   2e-04
At4g05230.1 68417.m00789 ubiquitin family protein contains INTER...    43   2e-04
At5g24240.1 68418.m02852 phosphatidylinositol 3- and 4-kinase fa...    40   0.002
At5g16090.1 68418.m01880 ubiquitin family protein contains INTER...    39   0.003
At1g53980.1 68414.m06149 polyubiquitin-related contains similari...    39   0.003
At3g06455.1 68416.m00747 splicing factor-related contains weak s...    38   0.004
At4g03360.1 68417.m00458 ubiquitin family protein contains INTER...    38   0.006
At4g02950.1 68417.m00402 ubiquitin family protein contains INTER...    38   0.008
At4g05250.1 68417.m00793 ubiquitin family protein contains INTER...    37   0.013
At4g05310.1 68417.m00809 ubiquitin family protein contains INTER...    35   0.041
At4g05270.1 68417.m00797 ubiquitin family protein contains INTER...    35   0.041
At1g26270.1 68414.m03205 phosphatidylinositol 3- and 4-kinase fa...    34   0.072
At1g11970.1 68414.m01383 hypothetical protein                          33   0.13 
At5g14360.1 68418.m01678 ubiquitin family protein contains INTER...    33   0.17 
At5g40630.1 68418.m04932 ubiquitin family protein contains INTER...    31   0.51 
At5g12280.1 68418.m01444 hypothetical protein                          30   1.2  
At1g64470.1 68414.m07309 ubiquitin family protein contains INTER...    30   1.2  
At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp...    30   1.2  
At3g14130.1 68416.m01787 (S)-2-hydroxy-acid oxidase, peroxisomal...    30   1.5  
At1g47680.1 68414.m05297 hypothetical protein                          30   1.5  
At3g14150.1 68416.m01789 (S)-2-hydroxy-acid oxidase, peroxisomal...    29   2.7  
At4g18360.1 68417.m02723 (S)-2-hydroxy-acid oxidase, peroxisomal...    28   6.2  
At1g22050.1 68414.m02758 ubiquitin family protein contains INTER...    28   6.2  

>At1g23410.1 68414.m02932 ubiquitin extension protein, putative /
           40S ribosomal protein S27A (RPS27aA) strong similarity
           to ubiquitin extension protein (UBQ5) GB:AAA32906
           GI:166934 from (Arabidopsis thaliana)
          Length = 156

 Score =  206 bits (504), Expect = 8e-54
 Identities = 103/155 (66%), Positives = 114/155 (73%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRE 268
           IQKESTLHLV            K Y+ P          KLAVL+FYKVD +GK+ RL++E
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHTHKKVKLAVLQFYKVDGSGKVQRLKKE 120

Query: 267 CTGEQCGAGVFMAVMEDRHYCGKCHSTMVFKDDDK 163
           C    CG G FMA   DRHYCGKC +T VFK  D+
Sbjct: 121 CPSVSCGPGTFMASHFDRHYCGKCGTTYVFKKADE 155


>At2g47110.1 68415.m05883 ubiquitin extension protein 6 (UBQ6) / 40S
           ribosomal protein S27A (RPS27aB) identical to GI:166936
          Length = 157

 Score =  204 bits (499), Expect = 3e-53
 Identities = 102/153 (66%), Positives = 113/153 (73%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRE 268
           IQKESTLHLV            K Y+ P          KLAVL+FYKVD +GK+ RLR+E
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKE 120

Query: 267 CTGEQCGAGVFMAVMEDRHYCGKCHSTMVFKDD 169
           C    CGAG FMA   DRHYCGKC  T V++ +
Sbjct: 121 CPNATCGAGTFMASHFDRHYCGKCGLTYVYQKE 153


>At3g62250.1 68416.m06993 ubiquitin extension protein 5 (UBQ5) / 40S
           ribosomal protein S27A (RPS27aC) identical to GI:166933,
           GI:166934
          Length = 157

 Score =  204 bits (498), Expect = 4e-53
 Identities = 101/153 (66%), Positives = 113/153 (73%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRE 268
           IQKESTLHLV            K Y+ P          KLAVL+FYK+D +GK+ RLR+E
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKIDGSGKVQRLRKE 120

Query: 267 CTGEQCGAGVFMAVMEDRHYCGKCHSTMVFKDD 169
           C    CGAG FMA   DRHYCGKC  T V++ +
Sbjct: 121 CPNATCGAGTFMASHFDRHYCGKCGLTYVYQKE 153


>At5g20620.1 68418.m02449 polyubiquitin (UBQ4) identical to GI:17677
          Length = 382

 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374


>At5g03240.2 68418.m00273 polyubiquitin (UBQ3) identical to
           GI:928809
          Length = 306

 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298


>At5g03240.1 68418.m00272 polyubiquitin (UBQ3) identical to
           GI:928809
          Length = 306

 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298


>At4g05320.5 68417.m00814 polyubiquitin (UBQ10) (SEN3)
           senescence-associated protein; identical to GI:870791
          Length = 312

 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score = 66.5 bits (155), Expect = 1e-11
 Identities = 32/34 (94%), Positives = 33/34 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE 526
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKE
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE 262



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 21/49 (42%), Positives = 25/49 (51%)
 Frame = -2

Query: 548 KLKFKTKRESLPINRG*XLLESSWKMDVPXRTTISRRNPPSTWC*GFVV 402
           K K + K   L  +     LESS +MDV   TT SRR+   TW   FVV
Sbjct: 255 KAKIQDKEVFLRTSSVSSSLESSLRMDVLWPTTTSRRSLLFTWSCVFVV 303


>At4g05320.4 68417.m00813 polyubiquitin (UBQ10) (SEN3)
           senescence-associated protein; identical to GI:870791
          Length = 464

 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score = 66.5 bits (155), Expect = 1e-11
 Identities = 32/34 (94%), Positives = 33/34 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE 526
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKE
Sbjct: 381 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE 414



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 21/49 (42%), Positives = 25/49 (51%)
 Frame = -2

Query: 548 KLKFKTKRESLPINRG*XLLESSWKMDVPXRTTISRRNPPSTWC*GFVV 402
           K K + K   L  +     LESS +MDV   TT SRR+   TW   FVV
Sbjct: 407 KAKIQDKEVFLRTSSVSSSLESSLRMDVLWPTTTSRRSLLFTWSCVFVV 455


>At4g05320.3 68417.m00812 polyubiquitin (UBQ10) (SEN3)
           senescence-associated protein; identical to GI:870791
          Length = 388

 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score = 66.5 bits (155), Expect = 1e-11
 Identities = 32/34 (94%), Positives = 33/34 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE 526
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKE
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE 338



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 21/49 (42%), Positives = 25/49 (51%)
 Frame = -2

Query: 548 KLKFKTKRESLPINRG*XLLESSWKMDVPXRTTISRRNPPSTWC*GFVV 402
           K K + K   L  +     LESS +MDV   TT SRR+   TW   FVV
Sbjct: 331 KAKIQDKEVFLRTSSVSSSLESSLRMDVLWPTTTSRRSLLFTWSCVFVV 379


>At4g05320.2 68417.m00811 polyubiquitin (UBQ10) (SEN3)
           senescence-associated protein; identical to GI:870791
          Length = 464

 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score = 66.5 bits (155), Expect = 1e-11
 Identities = 32/34 (94%), Positives = 33/34 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE 526
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKE
Sbjct: 381 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE 414



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 21/49 (42%), Positives = 25/49 (51%)
 Frame = -2

Query: 548 KLKFKTKRESLPINRG*XLLESSWKMDVPXRTTISRRNPPSTWC*GFVV 402
           K K + K   L  +     LESS +MDV   TT SRR+   TW   FVV
Sbjct: 407 KAKIQDKEVFLRTSSVSSSLESSLRMDVLWPTTTSRRSLLFTWSCVFVV 455


>At4g05320.1 68417.m00810 polyubiquitin (UBQ10) (SEN3)
           senescence-associated protein; identical to GI:870791
          Length = 388

 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score = 66.5 bits (155), Expect = 1e-11
 Identities = 32/34 (94%), Positives = 33/34 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE 526
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKE
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE 338



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 21/49 (42%), Positives = 25/49 (51%)
 Frame = -2

Query: 548 KLKFKTKRESLPINRG*XLLESSWKMDVPXRTTISRRNPPSTWC*GFVV 402
           K K + K   L  +     LESS +MDV   TT SRR+   TW   FVV
Sbjct: 331 KAKIQDKEVFLRTSSVSSSLESSLRMDVLWPTTTSRRSLLFTWSCVFVV 379


>At4g05050.1 68417.m00744 polyubiquitin (UBQ11) identical to
           GI:304117
          Length = 229

 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222


>At4g02890.3 68417.m00391 polyubiquitin (UBQ14) identical to
           GI:166795; similar to N. sylvestris hexameric
           polyubiquitin, GenBank accession number M74101
          Length = 305

 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298


>At4g02890.2 68417.m00390 polyubiquitin (UBQ14) identical to
           GI:166795; similar to N. sylvestris hexameric
           polyubiquitin, GenBank accession number M74101
          Length = 229

 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222


>At4g02890.1 68417.m00389 polyubiquitin (UBQ14) identical to
           GI:166795; similar to N. sylvestris hexameric
           polyubiquitin, GenBank accession number M74101
          Length = 305

 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298


>At3g52590.1 68416.m05792 ubiquitin extension protein 1 (UBQ1) / 60S
           ribosomal protein L40 (RPL40B) identical to GI:166929,
           GI:166930
          Length = 128

 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>At2g36170.1 68415.m04439 ubiquitin extension protein 2 (UBQ2) / 60S
           ribosomal protein L40 (RPL40A) identical to GI:166930,
           GI:166931
          Length = 128

 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>At2g35635.1 68415.m04370 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 154

 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score = 89.8 bits (213), Expect = 1e-18
 Identities = 40/68 (58%), Positives = 53/68 (77%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           I VKTLTGK I +++EP+DTI+ +K ++++KEGIPP QQRL +AGKQL D +T  DY I+
Sbjct: 79  IKVKTLTGKEIEIDIEPTDTIDRIKERVEEKEGIPPVQQRLIYAGKQLADDKTAKDYAIE 138

Query: 441 KESTLHLV 418
             S LHLV
Sbjct: 139 GGSVLHLV 146


>At1g65350.1 68414.m07413 polyubiquitin, putative similar to
           polyubiquitin GI:248337 from [Zea mays]
          Length = 294

 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  132 bits (319), Expect = 2e-31
 Identities = 64/70 (91%), Positives = 67/70 (95%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKE IPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 152 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYN 211

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 212 IQKESTLHLV 221



 Score =  128 bits (309), Expect = 3e-30
 Identities = 64/70 (91%), Positives = 67/70 (95%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+D N
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD-N 135

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 136 IQKESTLHLV 145



 Score = 97.1 bits (231), Expect = 9e-21
 Identities = 47/53 (88%), Positives = 49/53 (92%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDG 469
           MQIFVKTLTGKTITLEVE S TI+NVKAKIQDKEGIPP+QQRL FAGKQLE G
Sbjct: 228 MQIFVKTLTGKTITLEVESSGTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEGG 280


>At1g31340.1 68414.m03835 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 156

 Score =  135 bits (327), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score = 93.1 bits (221), Expect = 1e-19
 Identities = 41/68 (60%), Positives = 54/68 (79%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           I VKTLTGK I +++EP+DTI+ +K ++++KEGIPP QQRL +AGKQL D +T  DYNI+
Sbjct: 79  IKVKTLTGKEIEIDIEPTDTIDRIKERVEEKEGIPPVQQRLIYAGKQLADDKTAKDYNIE 138

Query: 441 KESTLHLV 418
             S LHLV
Sbjct: 139 GGSVLHLV 146


>At1g55060.1 68414.m06289 polyubiquitin (UBQ12) identical to
           polyubiquitin (ubq12) gene sequence GI:304121 from
           [Arabidopsis thaliana]
          Length = 230

 Score =  134 bits (324), Expect = 5e-32
 Identities = 64/70 (91%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+N+KAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNLKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  129 bits (312), Expect = 1e-30
 Identities = 63/70 (90%), Positives = 66/70 (94%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGI P+QQRL FAGKQ EDGRTL+DYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGISPDQQRLIFAGKQHEDGRTLADYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  120 bits (288), Expect = 1e-27
 Identities = 56/70 (80%), Positives = 64/70 (91%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIF+KTLTGKT  LEVE SDTI+NVKAKIQD EGIPP+Q RL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFLKTLTGKTKVLEVESSDTIDNVKAKIQDIEGIPPDQHRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           +Q++STLHL+
Sbjct: 61  VQEDSTLHLL 70


>At5g37640.1 68418.m04533 polyubiquitin (UBQ9) identical to
           polyubiquitin (ubq9) gene sequence GI:304120 from
           [Arabidopsis thaliana]
          Length = 322

 Score =  134 bits (323), Expect = 6e-32
 Identities = 63/70 (90%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEG+PP+QQRL FAGKQL+DGRTL+DYN
Sbjct: 79  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGVPPDQQRLIFAGKQLDDGRTLADYN 138

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 139 IQKESTLHLV 148



 Score =  127 bits (306), Expect = 7e-30
 Identities = 61/70 (87%), Positives = 65/70 (92%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFV+TLT KTI LEVE SDT +NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 155 MQIFVRTLTRKTIALEVESSDTTDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 214

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 215 IQKESTLHLV 224



 Score =  118 bits (284), Expect = 3e-27
 Identities = 60/71 (84%), Positives = 64/71 (90%), Gaps = 1/71 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDG-RTLSDY 451
           MQIFV TLTGKTITLEVE SDTI+NVKAKIQDKE I P+QQRL FAG+QLEDG  TL+DY
Sbjct: 231 MQIFVNTLTGKTITLEVESSDTIDNVKAKIQDKERIQPDQQRLIFAGEQLEDGYYTLADY 290

Query: 450 NIQKESTLHLV 418
           NIQKESTLHLV
Sbjct: 291 NIQKESTLHLV 301



 Score =  103 bits (246), Expect = 1e-22
 Identities = 50/71 (70%), Positives = 59/71 (83%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           + MQI  KTLT KTIT++V  SDTI NVKAKIQD EGIP +QQRL F+GK L+DGRTL+D
Sbjct: 1   MSMQIHAKTLTEKTITIDVVSSDTINNVKAKIQDIEGIPLDQQRLIFSGKLLDDGRTLAD 60

Query: 453 YNIQKESTLHL 421
           Y+IQK+S LHL
Sbjct: 61  YSIQKDSILHL 71


>At3g09790.1 68416.m01163 polyubiquitin (UBQ8) identical to
           polyubiquitin (ubq8) GI:870793, GB:L05917 [Arabidopsis
           thaliana] (Genetics 139 (2), 921-939 (1995))
          Length = 631

 Score =  128 bits (308), Expect = 4e-30
 Identities = 62/70 (88%), Positives = 66/70 (94%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFV+TLTGKTITLEV+ SDTI+NVKAKIQDKEGI P QQRL FAGKQLEDGRTL+DYN
Sbjct: 79  MQIFVQTLTGKTITLEVKSSDTIDNVKAKIQDKEGILPRQQRLIFAGKQLEDGRTLADYN 138

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 139 IQKESTLHLV 148



 Score =  115 bits (277), Expect = 2e-26
 Identities = 56/70 (80%), Positives = 63/70 (90%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +QI+ KTLT KTITL+VE SD+I NVKAKIQ+KEGIP +QQRL FAGKQLEDG TL+DYN
Sbjct: 3   IQIYAKTLTEKTITLDVETSDSIHNVKAKIQNKEGIPLDQQRLIFAGKQLEDGLTLADYN 62

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 63  IQKESTLHLV 72



 Score =  105 bits (251), Expect = 3e-23
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 2/75 (2%)
 Frame = -1

Query: 636 RVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGI--PPNQQRLXFAGKQLEDGRT 463
           R  MQIFVKTLT K I LEVE  DTIENVKA +QDKEGI   PN QRL F GK+L+DG T
Sbjct: 316 RCGMQIFVKTLTRKRINLEVESWDTIENVKAMVQDKEGIQPQPNLQRLIFLGKELKDGCT 375

Query: 462 LSDYNIQKESTLHLV 418
           L+DY+IQKESTLHLV
Sbjct: 376 LADYSIQKESTLHLV 390



 Score =  104 bits (250), Expect = 4e-23
 Identities = 52/70 (74%), Positives = 58/70 (82%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIF+KTLTGKTI LEVE SDTI NVK KIQ KEGI P+QQ L F G+QLEDG TL DY+
Sbjct: 552 MQIFIKTLTGKTIILEVESSDTIANVKEKIQVKEGIKPDQQMLIFFGQQLEDGVTLGDYD 611

Query: 447 IQKESTLHLV 418
           I K+STL+LV
Sbjct: 612 IHKKSTLYLV 621



 Score =  100 bits (240), Expect = 7e-22
 Identities = 50/69 (72%), Positives = 55/69 (79%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVK   GK ITLEV  SDTI++VKAKIQDK G PP+QQ L F G QL+DGRTL DYN
Sbjct: 393 MQIFVKLFGGKIITLEVLSSDTIKSVKAKIQDKVGSPPDQQILLFRGGQLQDGRTLGDYN 452

Query: 447 IQKESTLHL 421
           I+ ESTLHL
Sbjct: 453 IRNESTLHL 461



 Score = 90.6 bits (215), Expect = 8e-19
 Identities = 50/78 (64%), Positives = 56/78 (71%), Gaps = 5/78 (6%)
 Frame = -1

Query: 636 RVKMQIFVKTL-----TGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLED 472
           R  M IFVK L     TG+   LEVE SDTI+NVKAK+QDKE IP +  RL FAGK LE 
Sbjct: 235 RGDMYIFVKNLPYNSFTGENFILEVESSDTIDNVKAKLQDKERIPMDLHRLIFAGKPLEG 294

Query: 471 GRTLSDYNIQKESTLHLV 418
           GRTL+ YNIQK STL+LV
Sbjct: 295 GRTLAHYNIQKGSTLYLV 312



 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 47/76 (61%), Positives = 57/76 (75%), Gaps = 7/76 (9%)
 Frame = -1

Query: 627 MQIFVKTLTGK-----TITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQL--EDG 469
           MQIFV T +GK     T+TL+VE SDTIENVKAKIQD+EG+ P+ QRL F G++L  ED 
Sbjct: 155 MQIFVSTFSGKNFTSDTLTLKVESSDTIENVKAKIQDREGLRPDHQRLIFHGEELFTEDN 214

Query: 468 RTLSDYNIQKESTLHL 421
           RTL+DY I+  STL L
Sbjct: 215 RTLADYGIRNRSTLCL 230



 Score = 86.6 bits (205), Expect = 1e-17
 Identities = 48/75 (64%), Positives = 53/75 (70%), Gaps = 7/75 (9%)
 Frame = -1

Query: 627 MQIFVKTL-------TGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDG 469
           MQIFVKT        T KTITLEVE SDTI+NVK KIQ K GIP ++QRL F G+ L   
Sbjct: 469 MQIFVKTFSFSGETPTCKTITLEVESSDTIDNVKVKIQHKVGIPLDRQRLIFGGRVLVGS 528

Query: 468 RTLSDYNIQKESTLH 424
           RTL DYNIQK ST+H
Sbjct: 529 RTLLDYNIQKGSTIH 543


>At1g53930.1 68414.m06139 ubiquitin family protein contains Pfam
           profile: PF00240 ubiquitin family
          Length = 158

 Score =  109 bits (261), Expect = 2e-24
 Identities = 51/70 (72%), Positives = 59/70 (84%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M IF+KTLTG+ I LEVE  DTIEN+KAKIQDK+GIP +QQRL F GKQLEDG TL+DYN
Sbjct: 86  MFIFIKTLTGRRIVLEVENCDTIENIKAKIQDKQGIPVDQQRLIFKGKQLEDGLTLADYN 145

Query: 447 IQKESTLHLV 418
           IQ +S LHL+
Sbjct: 146 IQNDSILHLI 155


>At1g11980.1 68414.m01384 ubiquitin family protein similar to Chain
           A, Structure Of Ubiquitin-Like Protein, Rub1 GI:6729726
           from [Arabidopsis thaliana]
          Length = 78

 Score = 83.4 bits (197), Expect = 1e-16
 Identities = 38/70 (54%), Positives = 51/70 (72%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M+I VKTLT K I +E+E +DTIE +K +I++KEGIPP  QR+ + GKQL D  T   YN
Sbjct: 1   MEIKVKTLTEKQIDIEIELTDTIERIKERIEEKEGIPPVHQRIVYTGKQLADDLTAKHYN 60

Query: 447 IQKESTLHLV 418
           +++ S LHLV
Sbjct: 61  LERGSVLHLV 70


>At1g53950.1 68414.m06145 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 216

 Score = 65.3 bits (152), Expect = 3e-11
 Identities = 32/69 (46%), Positives = 47/69 (68%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           V M+IFV T+  KT  LEV+ SDTI+ +K+ I D+ G P +QQ L   G +L++  T+SD
Sbjct: 139 VLMRIFVSTIKEKTFILEVKGSDTIKKLKSMIHDQGGPPVDQQDLNHLGTKLKNNATISD 198

Query: 453 YNIQKESTL 427
           YNI+ ++ L
Sbjct: 199 YNIKPDANL 207



 Score = 64.5 bits (150), Expect = 6e-11
 Identities = 30/48 (62%), Positives = 37/48 (77%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGK 484
           M IF+KTLTG+T T EV+ SDTI  +KAK ++KEGIP  QQRL F G+
Sbjct: 50  MMIFIKTLTGRTNTYEVKGSDTIRELKAKHEEKEGIPVEQQRLIFQGR 97



 Score = 28.3 bits (60), Expect = 4.7
 Identities = 14/27 (51%), Positives = 17/27 (62%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVK 547
           M I +KTL GK I LEVE S    ++K
Sbjct: 1   MHISIKTLEGKRIKLEVEDSSNTIDLK 27


>At5g42220.1 68418.m05139 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 879

 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 27/70 (38%), Positives = 45/70 (64%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ +KTL  +T T +V  ++T+   K KI  + G+P  QQRL F G+ L+D   LS+Y+
Sbjct: 24  LELNIKTLDSRTYTFQVNKNETVLLFKEKIASETGVPVGQQRLIFRGRVLKDDHPLSEYH 83

Query: 447 IQKESTLHLV 418
           ++   TLHL+
Sbjct: 84  LENGHTLHLI 93


>At4g12570.1 68417.m01983 ubiquitin-protein ligase, putative similar
           to SP|P39940 Ubiquitin--protein ligase RSP5 (EC 6.3.2.-)
           {Saccharomyces cerevisiae}; contains Pfam profiles
           PF00240: Ubiquitin family, PF00632: HECT-domain
           (ubiquitin-transferase)
          Length = 873

 Score = 59.3 bits (137), Expect = 2e-09
 Identities = 28/72 (38%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = -1

Query: 630 KMQIFVKTLTG-KTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           ++QIFV+ ++G KTI +  E  DT+E +  +I+ K  IP  +QR+ + GKQL+   +L+ 
Sbjct: 94  RLQIFVRMMSGGKTIVIHAEKYDTVEKLHQRIEWKTKIPALEQRVIYKGKQLQRENSLTY 153

Query: 453 YNIQKESTLHLV 418
           Y+I+++++L LV
Sbjct: 154 YSIEQDASLQLV 165


>At5g38470.1 68418.m04650 DNA repair protein RAD23, putative similar
           to DNA repair by nucleotide excision (NER) RAD23
           protein, isoform I GI:1914683 from [Daucus carota]
          Length = 378

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 2/67 (2%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG--IPPNQQRLXFAGKQLEDGRTLSD 454
           M+IFVKTL+G    +EV+P+D + +VK  I+  +G   P  +Q L   GK L+D  TL +
Sbjct: 1   MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAEYPAAKQMLIHQGKVLKDETTLEE 60

Query: 453 YNIQKES 433
            N+ + S
Sbjct: 61  NNVVENS 67


>At2g17190.1 68415.m01985 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 538

 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 23/72 (31%), Positives = 39/72 (54%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           V + + V+   G   ++      T+E+ K  I     +P NQQRL + G+ L+D +TL  
Sbjct: 16  VAVAVNVRCSNGTKFSVTTSLDSTVESFKELIAQNSDVPANQQRLIYKGRILKDDQTLLS 75

Query: 453 YNIQKESTLHLV 418
           Y +Q + T+H+V
Sbjct: 76  YGLQADHTVHMV 87


>At4g02970.1 68417.m00404 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 270

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 25/69 (36%), Positives = 40/69 (57%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M +++ T TG + ++ ++  +T+  +K KI+  +GIP ++Q L   GK LED     DY 
Sbjct: 1   MNVYIDTETGSSFSITIDFGETVLEIKEKIEKSQGIPVSKQILYLDGKALEDDLHKIDYM 60

Query: 447 IQKESTLHL 421
           I  ES L L
Sbjct: 61  ILFESRLLL 69


>At2g17200.1 68415.m01986 ubiquitin family protein weak similarity
           to PLIC-2 (ubiquitin-like type II) [Homo sapiens]
           GI:9937505; contains Pfam profiles PF00240: Ubiquitin
           family, PF00627: UBA/TS-N domain
          Length = 551

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 20/66 (30%), Positives = 37/66 (56%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKE 436
           ++   G   +++     T+E+ K  +     +P NQQRL + G+ L+D +TL  Y +Q +
Sbjct: 22  IRCSNGTKFSVKTSLDSTVESFKELVAQSSDVPANQQRLIYKGRILKDDQTLLSYGLQAD 81

Query: 435 STLHLV 418
            T+H+V
Sbjct: 82  HTIHMV 87


>At4g03350.1 68417.m00457 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 263

 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 24/67 (35%), Positives = 38/67 (56%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M + + T TG + ++ ++  +T+  +K KI+  +GIP ++Q L   GK LED     DY 
Sbjct: 1   MNVDIDTETGSSFSITIDFGETVLQIKEKIEKSQGIPVSKQILYLDGKALEDDLHKIDYM 60

Query: 447 IQKESTL 427
           I  ES L
Sbjct: 61  ILFESLL 67


>At3g02540.2 68416.m00243 ubiquitin family protein contains Pfam
           profiles PF00240: Ubiquitin family, PF00627: UBA/TS-N
           domain;
          Length = 299

 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 3/68 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLS 457
           M+IFVKTL G    +EV+P D++ +VK  I+  +G    P  +Q L   GK L+D  T+ 
Sbjct: 1   MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE 60

Query: 456 DYNIQKES 433
           +  + + S
Sbjct: 61  ENKVAENS 68


>At3g02540.1 68416.m00242 ubiquitin family protein contains Pfam
           profiles PF00240: Ubiquitin family, PF00627: UBA/TS-N
           domain;
          Length = 419

 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 3/68 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLS 457
           M+IFVKTL G    +EV+P D++ +VK  I+  +G    P  +Q L   GK L+D  T+ 
Sbjct: 1   MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE 60

Query: 456 DYNIQKES 433
           +  + + S
Sbjct: 61  ENKVAENS 68


>At3g13235.1 68416.m01666 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 414

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 22/70 (31%), Positives = 42/70 (60%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M+I V T   + ITL+V+  +T+ENVKA ++ +  +P  QQ+L + G ++ +   LS   
Sbjct: 1   MRITVMTAGEQIITLDVDSQETVENVKALLEVESNVPIQQQQLLYNGNEMGNSDKLSALG 60

Query: 447 IQKESTLHLV 418
           ++ +  L ++
Sbjct: 61  VKDDDLLMMM 70


>At4g03370.1 68417.m00459 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 295

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 22/69 (31%), Positives = 41/69 (59%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++ V+  +G T ++++   DT+   K KI+  + IP ++Q + F GK LED   + +++
Sbjct: 1   MKMTVENESGSTFSIDIGLQDTVLTFKRKIEMTQRIPVSRQTIFFQGKLLEDHLDIFEWD 60

Query: 447 IQKESTLHL 421
           I +   LHL
Sbjct: 61  ILQNPLLHL 69


>At1g79650.3 68414.m09289 DNA repair protein RAD23, putative similar
           to DNA repair by nucleotide excision (NER) RAD23
           protein, isoform II GI:1914685 from [Daucus carota];
           contains Pfam profiles PF00240: Ubiquitin family,
           PF00627: UBA/TS-N domain
          Length = 351

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 3/70 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLS 457
           M++ VKTL G    + V PSDTI  VK  I+D +G    P  QQ L   GK L+D  +L 
Sbjct: 1   MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV 60

Query: 456 DYNIQKESTL 427
           +  + +E  L
Sbjct: 61  ENKVTEEGFL 70


>At1g79650.2 68414.m09288 DNA repair protein RAD23, putative similar
           to DNA repair by nucleotide excision (NER) RAD23
           protein, isoform II GI:1914685 from [Daucus carota];
           contains Pfam profiles PF00240: Ubiquitin family,
           PF00627: UBA/TS-N domain
          Length = 365

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 3/70 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLS 457
           M++ VKTL G    + V PSDTI  VK  I+D +G    P  QQ L   GK L+D  +L 
Sbjct: 1   MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV 60

Query: 456 DYNIQKESTL 427
           +  + +E  L
Sbjct: 61  ENKVTEEGFL 70


>At1g79650.1 68414.m09287 DNA repair protein RAD23, putative similar
           to DNA repair by nucleotide excision (NER) RAD23
           protein, isoform II GI:1914685 from [Daucus carota];
           contains Pfam profiles PF00240: Ubiquitin family,
           PF00627: UBA/TS-N domain
          Length = 371

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 3/70 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLS 457
           M++ VKTL G    + V PSDTI  VK  I+D +G    P  QQ L   GK L+D  +L 
Sbjct: 1   MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV 60

Query: 456 DYNIQKESTL 427
           +  + +E  L
Sbjct: 61  ENKVTEEGFL 70


>At1g16190.1 68414.m01939 DNA repair protein RAD23, putative similar
           to DNA repair by nucleotide excision (NER) RAD23
           protein, isoform II GI:1914685 from [Daucus carota]
          Length = 368

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 3/70 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQD---KEGIPPNQQRLXFAGKQLEDGRTLS 457
           M++ VKTL G    + V P+DTI  VK  I+D   K+  P  QQ L   GK L+D  TL 
Sbjct: 1   MKLTVKTLKGSHFEIRVLPTDTIMAVKKNIEDSQSKDNYPCGQQLLIHNGKVLKDETTLV 60

Query: 456 DYNIQKESTL 427
           +  + +E  L
Sbjct: 61  ENKVTEEGFL 70


>At1g32750.1 68414.m04038 HAC13 protein (HAC13) identical to HAC13
           [Arabidopsis thaliana] gi|21105767|gb|AAM34782; contains
           Pfam domains, PF00439: Bromodomain and PF00240:
           Ubiquitin family
          Length = 1919

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 23/74 (31%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = -1

Query: 636 RVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQ-RLXFAGKQLEDGRTL 460
           R  M+I VK+L GK   L V   +++ +++AK   K      +  ++ + GK+L+D ++L
Sbjct: 658 RGSMKIIVKSLGGKGSKLHVGIEESVSSLRAKASRKLDFKETEAVKMFYKGKELDDEKSL 717

Query: 459 SDYNIQKESTLHLV 418
           +  N+Q  S +HL+
Sbjct: 718 AAQNVQPNSLVHLI 731


>At5g09340.1 68418.m01082 ubiquitin, putative similar to ubiquitin
           SP:P42740 from [Aglaothamnion neglectum]
          Length = 79

 Score = 44.4 bits (100), Expect = 7e-05
 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGK---QLEDGRTLS 457
           MQ+F+    GK   +EVE + TI ++K KI D  G+    Q L   GK   ++  G T+ 
Sbjct: 1   MQVFIIDEDGKKYCVEVEKTTTIADMKTKIYDATGMENAYQYLEHRGKIVLEVHGGTTMD 60

Query: 456 DYNIQKESTLHL 421
           DY I+     H+
Sbjct: 61  DYKIKACDIFHM 72


>At4g01000.1 68417.m00135 ubiquitin family protein low similarity to
           SP|P13117 Ubiquitin. {Neurospora crassa}; contains Pfam
           profile PF00240: Ubiquitin family
          Length = 415

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVE-PSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           +Q FV+ L GK++TL    P    E +K +I ++  IP + QRL   G Q+ DG  +S  
Sbjct: 9   LQFFVRLLDGKSLTLSFSSPLAYGEQIKQRIFEQTKIPTHLQRLISGGYQISDGSAIS-- 66

Query: 450 NIQKESTLHLV 418
             Q ++T++LV
Sbjct: 67  --QPDATVNLV 75


>At3g19040.1 68416.m02418 ubiquitin family protein / DNA-binding
           bromodomain-containing protein low similarity to
           SP|P51123 Transcription initiation factor TFIID 230 kDa
           subunit {Drosophila melanogaster}; contains Pfam
           profiles: PF00439 bromodomain, PF00240: Ubiquitin family
          Length = 1700

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 22/71 (30%), Positives = 41/71 (57%), Gaps = 1/71 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQ-RLXFAGKQLEDGRTLSDY 451
           M+I +  L GK   L V   +++ ++KAK   K      +  ++ + GK+LED ++L++ 
Sbjct: 500 MKIKLSNLGGKGSLLTVGREESVSSLKAKASRKLDFKETEAVKMFYMGKELEDEKSLAEQ 559

Query: 450 NIQKESTLHLV 418
           N+Q  S +HL+
Sbjct: 560 NVQPNSLVHLL 570


>At2g46500.2 68415.m05791 phosphatidylinositol 3- and 4-kinase
           family protein / ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 566

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 2/68 (2%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKEG--IPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           VKT  GK     VE    I  VK +I  K G  + P++Q + + G++LED   ++D    
Sbjct: 115 VKTTCGKHCRFHVERGRNIGYVKKQISKKRGDFVDPDEQEILYEGEKLEDQSLINDICRN 174

Query: 441 KESTLHLV 418
            +S LHL+
Sbjct: 175 DDSVLHLL 182


>At2g46500.1 68415.m05790 phosphatidylinositol 3- and 4-kinase
           family protein / ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 566

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 2/68 (2%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKEG--IPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           VKT  GK     VE    I  VK +I  K G  + P++Q + + G++LED   ++D    
Sbjct: 115 VKTTCGKHCRFHVERGRNIGYVKKQISKKRGDFVDPDEQEILYEGEKLEDQSLINDICRN 174

Query: 441 KESTLHLV 418
            +S LHL+
Sbjct: 175 DDSVLHLL 182


>At4g05230.1 68417.m00789 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 206

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 22/69 (31%), Positives = 36/69 (52%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M +F +T +G T  +E+   DT+  +K KI+  + IP ++Q L F G  L+D   +    
Sbjct: 1   MDVFFETRSGSTFEIELGYWDTVLEIKQKIEKYQRIPVSKQTLLFQGNVLQDHLDIEQCV 60

Query: 447 IQKESTLHL 421
           I   S + L
Sbjct: 61  ILNHSRIQL 69


>At5g24240.1 68418.m02852 phosphatidylinositol 3- and 4-kinase
           family protein / ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain, Pfam profile
           PF00454:  Phosphatidylinositol 3- and 4-kinase
          Length = 574

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKE---GIPPNQQRLXFAGKQLEDGRTLSDY 451
           I V+T+ GK   L VE S  +  VK +I  KE   GIP + + L   G++L+D R ++D 
Sbjct: 111 ISVRTVDGKEFELVVERSRNVGYVKQQIASKEKELGIPRDHE-LTLDGEELDDQRLITDL 169

Query: 450 NIQKESTLHLV 418
               ++ +HL+
Sbjct: 170 CQNGDNVIHLL 180


>At5g16090.1 68418.m01880 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 142

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 3/73 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLS 457
           M+I VKTL G    +EV+P+D++  VK  I+   G    P  QQ L    ++L D  T+ 
Sbjct: 1   MKIIVKTLKGIRFEIEVKPNDSVAEVKKNIETVMGASEYPAAQQILIHKREKLRDETTME 60

Query: 456 DYNIQKESTLHLV 418
              +  +S + ++
Sbjct: 61  ANKVFDKSVIAII 73


>At1g53980.1 68414.m06149 polyubiquitin-related contains similarity
           to polyubiquitin GI:166336 from (Aglaothamnion
           neglectum)
          Length = 91

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 20/38 (52%), Positives = 25/38 (65%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP 514
           M IFV TL GKT  LEV+ S+ I+ VK  I D+  +PP
Sbjct: 49  MSIFVSTLKGKTFNLEVKGSEIIQQVKNMIHDQ--VPP 84



 Score = 28.7 bits (61), Expect = 3.6
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVK 547
           M+I +KT  GKTI LE+E S    ++K
Sbjct: 1   MKILIKTEKGKTINLELEDSSETIDIK 27


>At3g06455.1 68416.m00747 splicing factor-related contains weak
           similarity to Swiss-Prot:Q12874 splicing factor 3A
           subunit 3 (Spliceosome associated protein 61, SAP 61,
           SF3a60) [Homo sapiens]
          Length = 366

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEV-EPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           +Q FV+ L GK++TL    P    E +K +I ++  IP + QRL   G Q+     +S  
Sbjct: 9   LQFFVRLLDGKSVTLTFSSPIACGEQIKQRIFEQTKIPTHLQRLISGGFQIPGASAIS-- 66

Query: 450 NIQKESTLHLV 418
             Q ++T++LV
Sbjct: 67  --QSDTTMNLV 75


>At4g03360.1 68417.m00458 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 284

 Score = 37.9 bits (84), Expect = 0.006
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ ++  +G + T++V   DT+  +K KI+  +G P ++Q L F  K L+D   +    
Sbjct: 2   IKVIIENQSGSSFTIDVSFWDTVLMIKRKIEMTQGTPVSKQILIFKRKVLQDHLNMFGCQ 61

Query: 447 IQKESTLHL 421
           I+  S + L
Sbjct: 62  IRHNSRILL 70


>At4g02950.1 68417.m00402 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 318

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + + ++  +G + T++V   DT+  +K KI+  +G P ++Q L F  K L+D   +    
Sbjct: 36  ISVIIENQSGSSFTIDVSFWDTVLMIKRKIEMTQGTPVSKQILIFKRKVLQDHLNMFGCQ 95

Query: 447 IQKESTLHL 421
           I+  S + L
Sbjct: 96  IRHNSRILL 104


>At4g05250.1 68417.m00793 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 318

 Score = 36.7 bits (81), Expect = 0.013
 Identities = 18/52 (34%), Positives = 30/52 (57%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLED 472
           M +F +T +G    +E+   DT+  +K KI+  + IP ++Q L F G  L+D
Sbjct: 1   MDVFFETQSGDKFEIELGYWDTMLEIKEKIEKYQCIPVSKQTLIFQGVVLQD 52


>At4g05310.1 68417.m00809 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 415

 Score = 35.1 bits (77), Expect = 0.041
 Identities = 17/47 (36%), Positives = 28/47 (59%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAG 487
           M+  V+ L G +  +EVE +DT+  VK KI+  + +P ++Q L   G
Sbjct: 1   MKFVVEILGGSSFEIEVERTDTLLVVKQKIEKSQRVPVSKQTLIVDG 47


>At4g05270.1 68417.m00797 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 129

 Score = 35.1 bits (77), Expect = 0.041
 Identities = 18/47 (38%), Positives = 27/47 (57%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAG 487
           M+  V+ L G +  LEV+  DT+  VK KI+  + IP ++Q L   G
Sbjct: 1   MKFLVENLNGSSFELEVDYRDTLLVVKQKIERSQHIPVSKQTLIVDG 47


>At1g26270.1 68414.m03205 phosphatidylinositol 3- and 4-kinase
           family protein similar to phosphatidylinositol 4-kinase
           type-II beta [Homo sapiens] GI:20159767; contains Pfam
           profile PF00454: Phosphatidylinositol 3- and 4-kinase
          Length = 630

 Score = 34.3 bits (75), Expect = 0.072
 Identities = 18/56 (32%), Positives = 29/56 (51%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRT 463
           + ++FV+T TG  + LE++ SD    VK K+Q     P  +  L F    L++  T
Sbjct: 40  RRRVFVQTETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTFGDLVLKNDLT 95


>At1g11970.1 68414.m01383 hypothetical protein
          Length = 99

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 14/40 (35%), Positives = 26/40 (65%)
 Frame = -1

Query: 636 RVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIP 517
           R + ++  + L+ K I +E++P D IE +K  I+++ GIP
Sbjct: 40  RQRFKVKSQFLSEKKIDIEIDPMDKIEQIKEGIEEEIGIP 79


>At5g14360.1 68418.m01678 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 163

 Score = 33.1 bits (72), Expect = 0.17
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = -1

Query: 585 LEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLED 472
           L +E + T   +K  +    G+ P QQRL F GK+ ED
Sbjct: 83  LSIEATSTFGELKMVLSLLTGLEPKQQRLVFKGKERED 120


>At5g40630.1 68418.m04932 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 165

 Score = 31.5 bits (68), Expect = 0.51
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLED 472
           V T++  +  + ++ + T   +K  I    GI   +QRL F GK+ ED
Sbjct: 83  VSTVSQLSYEISIDANSTFGELKMMIAIVSGIEAKEQRLLFRGKERED 130


>At5g12280.1 68418.m01444 hypothetical protein
          Length = 419

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
 Frame = -1

Query: 597 KTITLEVEP-SDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           K + + V+  S+ + ++K KI  +   P N+Q+L      L+D  +L+ YN+
Sbjct: 357 KVVKITVQSLSENVASLKEKISGEIQFPTNKQKLRGKAGFLKDNTSLAHYNV 408


>At1g64470.1 68414.m07309 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 213

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 2/70 (2%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKI-QDKEGIPP-NQQRLXFAGKQLEDGRTLSDYN 448
           + V T  GK     V+    +  +K +I ++ +G P  + Q + F G++L+D R +    
Sbjct: 113 VTVITTCGKVFQFHVDRRRNVGYLKKRISKEGKGFPEVDDQEILFKGEKLDDNRIIDGIC 172

Query: 447 IQKESTLHLV 418
               S +HL+
Sbjct: 173 KDGNSVIHLL 182


>At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp
           domain-containing protein / ubiquitin family protein
           similar to SP|Q15459 Splicing factor 3 subunit 1
           (Spliceosome associated protein 114) {Homo sapiens};
           contains Pfam profiles PF00240: Ubiquitin family,
           PF01805: Surp module
          Length = 785

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = -1

Query: 570 SDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           S+ + ++K KI  +  IP N+Q+L      L+D  +L+ YN+
Sbjct: 726 SENVGSLKEKIAGEIQIPANKQKLSGKAGFLKDNMSLAHYNV 767


>At3g14130.1 68416.m01787 (S)-2-hydroxy-acid oxidase, peroxisomal,
           putative / glycolate oxidase, putative / short chain
           alpha-hydroxy acid oxidase, putative similar to Chain A,
           Glycolate Oxidase (E.C.1.1.3.15) Mutant With Tyr 24
           Replaced By Phe (Y24f) gi|999542
          Length = 363

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 2/42 (4%)
 Frame = +1

Query: 418 HQVEGGF--LLDIVVRXGTSIFQLLSSKXQPLLIGRDSLFVL 537
           H V+G    LLD  VR GT +F+ L+   Q +LIGR  ++ L
Sbjct: 272 HAVKGRIPVLLDGGVRRGTDVFKALALGAQAVLIGRPIVYGL 313


>At1g47680.1 68414.m05297 hypothetical protein
          Length = 104

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = -1

Query: 576 EPSDTIENVKAKIQDKEG-IPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHL 421
           E  D +E++  K  ++ G +     +L  +G+Q+   R L DY +Q E+T  L
Sbjct: 31  EEDDGMEDITKKYHNEVGEVVQGVPQLRRSGRQISQSRYLEDYVMQSETTYGL 83


>At3g14150.1 68416.m01789 (S)-2-hydroxy-acid oxidase, peroxisomal,
           putative / glycolate oxidase, putative / short chain
           alpha-hydroxy acid oxidase, putative similar to
           (S)-2-hydroxy-acid oxidase, peroxisomal (Glycolate
           oxidase, GOX) (Short chain alpha-hydroxy acid oxidase)
           [Spinacia oleracea] SWISS-PROT:P05414
          Length = 363

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +1

Query: 439 LLDIVVRXGTSIFQLLSSKXQPLLIGRDSLFVL 537
           LLD  VR GT +F+ L+   Q +LIGR  ++ L
Sbjct: 281 LLDGGVRRGTDVFKALALGAQAVLIGRPIIYGL 313


>At4g18360.1 68417.m02723 (S)-2-hydroxy-acid oxidase, peroxisomal,
           putative / glycolate oxidase, putative / short chain
           alpha-hydroxy acid oxidase, putative similar to
           (S)-2-hydroxy-acid oxidase, peroxisomal (Glycolate
           oxidase, GOX) (Short chain alpha-hydroxy acid oxidase)
           [Spinacia oleracea] SWISS-PROT:P05414
          Length = 368

 Score = 27.9 bits (59), Expect = 6.2
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +1

Query: 442 LDIVVRXGTSIFQLLSSKXQPLLIGRDSLFVL 537
           LD  VR GT +F+ L+     + +GR SLF L
Sbjct: 284 LDGGVRRGTDVFKALALGASGVFVGRPSLFSL 315


>At1g22050.1 68414.m02758 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 119

 Score = 27.9 bits (59), Expect = 6.2
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 7/46 (15%)
 Frame = -1

Query: 570 SDTIENVKAKI-----QDKEGIPP--NQQRLXFAGKQLEDGRTLSD 454
           S T+ ++K K+     +DKE  P   N  +L  AGK LE+ RTL++
Sbjct: 28  SMTVSSLKEKLISQWPKDKENTPKTVNDMKLINAGKILENNRTLAE 73


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,492,650
Number of Sequences: 28952
Number of extensions: 212500
Number of successful extensions: 725
Number of sequences better than 10.0: 69
Number of HSP's better than 10.0 without gapping: 645
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 719
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1363910256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -