SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B08
         (510 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g27350.1 68414.m03331 expressed protein contains 1 transmembr...    56   1e-08
At1g27330.1 68414.m03329 expressed protein similar to EST gb|AA6...    56   1e-08
At3g07650.2 68416.m00917 zinc finger (B-box type) family protein...    29   1.4  
At3g07650.1 68416.m00916 zinc finger (B-box type) family protein...    29   1.4  
At1g31960.1 68414.m03929 hypothetical protein                          29   2.4  
At5g48250.1 68418.m05961 zinc finger (B-box type) family protein...    28   4.2  
At1g27595.1 68414.m03365 expressed protein similar to Symplekin ...    27   5.5  
At3g28860.1 68416.m03602 multidrug resistance P-glycoprotein, pu...    27   7.3  

>At1g27350.1 68414.m03331 expressed protein contains 1 transmembrane
           domain; similar to ribosome associated membrane protein
           RAMP4 GI:4585827 [Rattus norvegicus]; similar to ESTs
           gb|T20610 and gb|AA586199
          Length = 68

 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 26/45 (57%), Positives = 33/45 (73%)
 Frame = +1

Query: 145 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279
           KNI  RG VP+TT +K   YPV P LL  F+FVV GS++FQII++
Sbjct: 17  KNILKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIRT 61


>At1g27330.1 68414.m03329 expressed protein similar to EST
           gb|AA650671 and gb|T20610
          Length = 68

 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 26/45 (57%), Positives = 33/45 (73%)
 Frame = +1

Query: 145 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279
           KNI  RG VP+TT +K   YPV P LL  F+FVV GS++FQII++
Sbjct: 17  KNILKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIRT 61


>At3g07650.2 68416.m00917 zinc finger (B-box type) family protein
           similar to zinc finger protein GB:BAA33206 [Oryza
           sativa]
          Length = 372

 Score = 29.5 bits (63), Expect = 1.4
 Identities = 13/38 (34%), Positives = 20/38 (52%)
 Frame = +3

Query: 150 HHNEGECTQNYQGKRRPISCGTLAPCSLHLRSVWLCCV 263
           +++    T   Q KR+ ISC +  P S  L S+W  C+
Sbjct: 82  NNSSSSSTSPQQHKRQTISCYSGCPSSSELASIWSFCL 119


>At3g07650.1 68416.m00916 zinc finger (B-box type) family protein
           similar to zinc finger protein GB:BAA33206 [Oryza
           sativa]
          Length = 372

 Score = 29.5 bits (63), Expect = 1.4
 Identities = 13/38 (34%), Positives = 20/38 (52%)
 Frame = +3

Query: 150 HHNEGECTQNYQGKRRPISCGTLAPCSLHLRSVWLCCV 263
           +++    T   Q KR+ ISC +  P S  L S+W  C+
Sbjct: 82  NNSSSSSTSPQQHKRQTISCYSGCPSSSELASIWSFCL 119


>At1g31960.1 68414.m03929 hypothetical protein
          Length = 173

 Score = 28.7 bits (61), Expect = 2.4
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = -1

Query: 480 NPVSVKETSSHDCTVKGTNGRLRKHSL 400
           NP S++     D  VKG+NG +R HS+
Sbjct: 105 NPTSIRRKLFDDAGVKGSNGVVRFHSV 131


>At5g48250.1 68418.m05961 zinc finger (B-box type) family protein
           contains similarity to CONSTANS homologs
          Length = 373

 Score = 27.9 bits (59), Expect = 4.2
 Identities = 13/40 (32%), Positives = 19/40 (47%)
 Frame = +3

Query: 153 HNEGECTQNYQGKRRPISCGTLAPCSLHLRSVWLCCVPDN 272
           H+    T     KR+ I+C +  P S  L S+W  C+  N
Sbjct: 76  HDGKNSTTTSHHKRQTINCYSGCPSSAELSSIWSFCMDLN 115


>At1g27595.1 68414.m03365 expressed protein similar to Symplekin
           (SP:Q92797) {Homo sapiens}
          Length = 1091

 Score = 27.5 bits (58), Expect = 5.5
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 2/64 (3%)
 Frame = +3

Query: 324 ENTIK*QHYPSKVRHNLHQHLF--VDMRESVFGGGH*YL*LCNRGLMSLSHLQGXNGTPI 497
           ++TI  +  P +VRHN + HL   V   ES+ G       +   G+ S +HL     TP+
Sbjct: 160 DDTINGEVAPKRVRHNTNMHLTQQVQTNESLQGP------VSINGISSGNHLSDSELTPV 213

Query: 498 HKVI 509
            +++
Sbjct: 214 EQMV 217


>At3g28860.1 68416.m03602 multidrug resistance P-glycoprotein,
           putative similar to mdr-like P-glycoprotein GI:3849833
           from [Arabidopsis thaliana]; contains Pfam profiles
           PF00005: ABC transporter and PF00664: ABC transporter
           transmembrane region; identical to cDNA MDR-like
           p-glycoprotein (At3g28860) GI:24324261
          Length = 1252

 Score = 27.1 bits (57), Expect = 7.3
 Identities = 11/23 (47%), Positives = 18/23 (78%)
 Frame = -2

Query: 188 SLVVLGTFPLIVMFLLAISLAIR 120
           SL++LGTFPL+V+   A  L+++
Sbjct: 833 SLLILGTFPLLVLANFAQQLSLK 855


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,162,916
Number of Sequences: 28952
Number of extensions: 232261
Number of successful extensions: 532
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 526
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 531
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 917929344
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -