SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B07
         (652 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g66010.1 68418.m08312 heterogeneous nuclear ribonucleoprotein...    31   0.88 
At5g18590.2 68418.m02198 kelch repeat-containing protein identic...    30   1.5  
At5g18590.1 68418.m02197 kelch repeat-containing protein identic...    30   1.5  
At3g14160.1 68416.m01790 oxidoreductase, 2OG-Fe(II) oxygenase fa...    28   4.7  
At5g17830.1 68418.m02090 hypothetical protein contains Pfam doma...    28   6.2  
At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly i...    27   8.2  
At3g11080.1 68416.m01339 disease resistance family protein conta...    27   8.2  

>At5g66010.1 68418.m08312 heterogeneous nuclear ribonucleoprotein,
           putative / hnRNP, putative similar to Heterogeneous
           nuclear ribonucleoprotein SP|P55795, SP|P31943,
           SP|P52597 {Homo sapiens}; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM) domain
          Length = 289

 Score = 30.7 bits (66), Expect = 0.88
 Identities = 15/47 (31%), Positives = 24/47 (51%)
 Frame = -3

Query: 386 SPKRHYGSSRSLNGAFKYHKHRSPPSANPSLATKGSTSKLTQPTEFL 246
           S + +Y +  +  GA++Y    SPP   PS A + S  +  + TE L
Sbjct: 156 SKQDYYNAVAAEEGAYEYEVRASPPPTGPSRAKRFSEKEKLEYTEVL 202


>At5g18590.2 68418.m02198 kelch repeat-containing protein identical
           to RanGAP1 interacting protein (GI:21950739)
           [Arabidopsis thaliana]; similar to Tip elongation
           aberrant protein 1 (Cell polarity protein tea1)
           (SP:P87061) [Schizosaccharomyces pombe]; contains Pfam
           PF01344: Kelch motif (5 repeats)
          Length = 708

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 14/42 (33%), Positives = 22/42 (52%)
 Frame = -3

Query: 395 ISQSPKRHYGSSRSLNGAFKYHKHRSPPSANPSLATKGSTSK 270
           ++ + + H GS R       +  HR+PPS N SL  + ST +
Sbjct: 432 LASAIEEHGGSGRRSLSEIAFGDHRNPPSGNVSLRKQFSTEE 473


>At5g18590.1 68418.m02197 kelch repeat-containing protein identical
           to RanGAP1 interacting protein (GI:21950739)
           [Arabidopsis thaliana]; similar to Tip elongation
           aberrant protein 1 (Cell polarity protein tea1)
           (SP:P87061) [Schizosaccharomyces pombe]; contains Pfam
           PF01344: Kelch motif (5 repeats)
          Length = 708

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 14/42 (33%), Positives = 22/42 (52%)
 Frame = -3

Query: 395 ISQSPKRHYGSSRSLNGAFKYHKHRSPPSANPSLATKGSTSK 270
           ++ + + H GS R       +  HR+PPS N SL  + ST +
Sbjct: 432 LASAIEEHGGSGRRSLSEIAFGDHRNPPSGNVSLRKQFSTEE 473


>At3g14160.1 68416.m01790 oxidoreductase, 2OG-Fe(II) oxygenase
           family protein low similarity to alkB protein
           [Caulobacter crescentus][GI:2055386]; contains Pfam
           domain PF03171 2OG-Fe(II) oxygenase superfamily
          Length = 313

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 3/56 (5%)
 Frame = +2

Query: 125 TAEIVFSTYADSDSLERLCQFLVDVLIYGAQTRRL---TEKVRRETQWAVLIYSSS 283
           +AE ++    D D  E L     DVL++G ++R++      +R++T    L+  +S
Sbjct: 245 SAEFLYGDQRDEDKAETLTLESGDVLLFGGRSRKVFHGVRSIRKDTAPKALLQETS 300


>At5g17830.1 68418.m02090 hypothetical protein contains Pfam domain,
           PF04515: Protein of unknown function, DUF580
          Length = 474

 Score = 27.9 bits (59), Expect = 6.2
 Identities = 12/42 (28%), Positives = 24/42 (57%)
 Frame = +3

Query: 81  VIILKVLVMFRAD*ELPRLFFLPMLIVIALRGYVSFLWTC*F 206
           ++ L+ LV  ++    P+ ++ P+L  +A+ G +S  W C F
Sbjct: 72  LLTLRGLVCTKSPNFHPKKWYTPLLSSVAVSGVLSIAWNCFF 113


>At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly
           identical to actin-related protein 6 (ARP6) [Arabidopsis
           thaliana] GI:21427467; contains Pfam profile PF00022:
           Actin
          Length = 421

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = +3

Query: 522 IDRQYLVYSRKYLPTWEHLFSSL 590
           IDR YL+ S      W HLF+SL
Sbjct: 65  IDRGYLINSDLQREIWSHLFTSL 87


>At3g11080.1 68416.m01339 disease resistance family protein contains
           leucine rich-repeat domains Pfam:PF00560,
           INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon
           pimpinellifolium] gi|1184077|gb|AAC15780
          Length = 943

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = -3

Query: 554 FSGINKILSINSTSKRGGTHLPLSLLQLIRTSAL 453
           F  +N+++ +   S +   ++P+SLL L R SAL
Sbjct: 265 FGNLNQLIVLQVDSNKLSGNVPISLLNLTRLSAL 298


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,745,541
Number of Sequences: 28952
Number of extensions: 281562
Number of successful extensions: 741
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 721
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 741
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1354097952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -