SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B05
         (653 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g37270.1 68415.m04572 40S ribosomal protein S5 (RPS5A) identi...   269   1e-72
At3g11940.2 68416.m01470 40S ribosomal protein S5 (RPS5B) simila...   266   7e-72
At3g11940.1 68416.m01469 40S ribosomal protein S5 (RPS5B) simila...   266   7e-72
At1g27180.1 68414.m03311 disease resistance protein (TIR-NBS-LRR...    29   2.7  
At5g01940.1 68418.m00113 eukaryotic translation initiation facto...    27   8.2  
At4g39955.1 68417.m05659 hydrolase, alpha/beta fold family prote...    27   8.2  
At1g79490.1 68414.m09264 pentatricopeptide (PPR) repeat-containi...    27   8.2  
At1g57600.1 68414.m06536 membrane bound O-acyl transferase (MBOA...    27   8.2  

>At2g37270.1 68415.m04572 40S ribosomal protein S5 (RPS5A) identical
           to GP:3043428
          Length = 207

 Score =  269 bits (659), Expect = 1e-72
 Identities = 129/164 (78%), Positives = 147/164 (89%), Gaps = 1/164 (0%)
 Frame = +2

Query: 164 EIKLFGRWSCYDVQVSDMSLQDYISVK-EKYAKYLPHSAGRYAHKRFRKAQCPIVERLTN 340
           E+KLF RWS  DV V+D+SL DYI V+  K+A ++PH+AGRY+ KRFRKAQCPIVERLTN
Sbjct: 18  EVKLFNRWSFDDVSVTDISLVDYIGVQPSKHATFVPHTAGRYSVKRFRKAQCPIVERLTN 77

Query: 341 SLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTV 520
           SLMMHGRNNGKKLMAVRIVKHA EIIHLL+  NP+QV++ AI+NSGPRED+TRIG AG V
Sbjct: 78  SLMMHGRNNGKKLMAVRIVKHAMEIIHLLSDLNPIQVIIDAIVNSGPREDATRIGSAGVV 137

Query: 521 RRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           RRQAVD+SPLRRVNQAI+LL TGAREAAFRNIKTIAEC+ADELI
Sbjct: 138 RRQAVDISPLRRVNQAIFLLTTGAREAAFRNIKTIAECLADELI 181


>At3g11940.2 68416.m01470 40S ribosomal protein S5 (RPS5B) similar
           to 40S ribosomal protein S5 GB:AAC98068 GI:4056502 from
           [Arabidopsis thaliana]
          Length = 207

 Score =  266 bits (653), Expect = 7e-72
 Identities = 129/170 (75%), Positives = 149/170 (87%), Gaps = 1/170 (0%)
 Frame = +2

Query: 146 QAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKE-KYAKYLPHSAGRYAHKRFRKAQCPI 322
           Q A   E+KLF RW+  DV V+D+SL DYI V+  K+A ++PH+AGRY+ KRFRKAQCPI
Sbjct: 12  QQALTNEVKLFNRWTYDDVTVTDISLVDYIGVQAAKHATFVPHTAGRYSVKRFRKAQCPI 71

Query: 323 VERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRI 502
           VERLTNSLMMHGRNNGKKLMAVRIVKHA EIIHLL+  NP+QV++ AI+NSGPRED+TRI
Sbjct: 72  VERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLSDLNPIQVIIDAIVNSGPREDATRI 131

Query: 503 GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           G AG VRRQAVD+SPLRRVNQAI+L+ TGAREAAFRNIKTIAEC+ADELI
Sbjct: 132 GSAGVVRRQAVDISPLRRVNQAIFLITTGAREAAFRNIKTIAECLADELI 181


>At3g11940.1 68416.m01469 40S ribosomal protein S5 (RPS5B) similar
           to 40S ribosomal protein S5 GB:AAC98068 GI:4056502 from
           [Arabidopsis thaliana]
          Length = 207

 Score =  266 bits (653), Expect = 7e-72
 Identities = 129/170 (75%), Positives = 149/170 (87%), Gaps = 1/170 (0%)
 Frame = +2

Query: 146 QAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKE-KYAKYLPHSAGRYAHKRFRKAQCPI 322
           Q A   E+KLF RW+  DV V+D+SL DYI V+  K+A ++PH+AGRY+ KRFRKAQCPI
Sbjct: 12  QQALTNEVKLFNRWTYDDVTVTDISLVDYIGVQAAKHATFVPHTAGRYSVKRFRKAQCPI 71

Query: 323 VERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRI 502
           VERLTNSLMMHGRNNGKKLMAVRIVKHA EIIHLL+  NP+QV++ AI+NSGPRED+TRI
Sbjct: 72  VERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLSDLNPIQVIIDAIVNSGPREDATRI 131

Query: 503 GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           G AG VRRQAVD+SPLRRVNQAI+L+ TGAREAAFRNIKTIAEC+ADELI
Sbjct: 132 GSAGVVRRQAVDISPLRRVNQAIFLITTGAREAAFRNIKTIAECLADELI 181


>At1g27180.1 68414.m03311 disease resistance protein (TIR-NBS-LRR
            class), putative domain signature TIR-NBS-LRR exists,
            suggestive of a disease resistance protein.
          Length = 1556

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 2/82 (2%)
 Frame = +3

Query: 105  PRQAAWL-WKPC-LYHKPPTFLKSSFSADGVATMCKSLICLCRTTFPLKRSTQNIYLIQL 278
            P +  W+ WK   L + PP  L       GV  + +S +   +T  P KR  +N+ ++ L
Sbjct: 795  PSELKWIQWKGFPLENLPPDILSRQL---GVLDLSESGVRRVKT-LPRKRGDENLKVVNL 850

Query: 279  AGMHTSVSVKPSAQSWSALQTL 344
             G H  +   P   + +AL+ L
Sbjct: 851  RGCH-GLEAIPDLSNHNALEKL 871


>At5g01940.1 68418.m00113 eukaryotic translation initiation factor
           2B family protein / eIF-2B family protein similar to
           SP|P41035 Eukaryotic translation initiation factor 2
           subunit (eIF-2-beta) {Oryctolagus cuniculus}; contains
           Pfam profile PF01873: Domain found in IF2B/IF5
          Length = 231

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 15/42 (35%), Positives = 22/42 (52%)
 Frame = +3

Query: 180 ADGVATMCKSLICLCRTTFPLKRSTQNIYLIQLAGMHTSVSV 305
           A+G  T+C +   LCRT   + R   ++    LA M T VS+
Sbjct: 109 AEGTITVCLNFADLCRT---MHRKPDHVMKFLLAQMETKVSL 147


>At4g39955.1 68417.m05659 hydrolase, alpha/beta fold family protein
           low similarity to SP|P24640|LIP3_MORSP Lipase 3
           precursor (EC 3.1.1.3) (Triacylglycerol lipase)
           {Moraxella sp}; contains Pfam profile PF00561:
           hydrolase, alpha/beta fold family
          Length = 328

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 9/25 (36%), Positives = 16/25 (64%)
 Frame = +3

Query: 141 YHKPPTFLKSSFSADGVATMCKSLI 215
           ++KPP ++ S F+ D +  MCK  +
Sbjct: 191 FYKPPIWIPSCFAMDYIHVMCKDYL 215


>At1g79490.1 68414.m09264 pentatricopeptide (PPR) repeat-containing
           protein low similarity to fertility restorer [Petunia x
           hybrida] GI:22128587; contains Pfam profile PF01535: PPR
           repeat
          Length = 836

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 22/89 (24%), Positives = 39/89 (43%)
 Frame = +2

Query: 212 DMSLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVR 391
           D+S   Y  V +  AK           K+ +++ C I  +  N+LMM   N G    A  
Sbjct: 240 DLSFNAYNQVIQYLAKAEKLEVAFCCFKKAQESGCKIDTQTYNNLMMLFLNKGLPYKAFE 299

Query: 392 IVKHAFEIIHLLTGENPLQVLVTAIINSG 478
           I +   +   LL G +  ++++ ++  SG
Sbjct: 300 IYESMEKTDSLLDG-STYELIIPSLAKSG 327


>At1g57600.1 68414.m06536 membrane bound O-acyl transferase (MBOAT)
           family protein low similarity to skinny hedgehog
           [Drosophila melanogaster] GI:15420842; contains Pfam
           profile PF03062: MBOAT family
          Length = 533

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = +3

Query: 117 AWLWKPCLYHKPPTFLKSSFSA 182
           +W W  CL+  P   LKS+ SA
Sbjct: 426 SWAWLTCLFFMPEMLLKSASSA 447


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,317,667
Number of Sequences: 28952
Number of extensions: 299108
Number of successful extensions: 727
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 718
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 724
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1363910256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -