SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B02
         (347 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g33865.1 68417.m04805 40S ribosomal protein S29 (RPS29C)            60   3e-10
At3g44010.1 68416.m04712 40S ribosomal protein S29 (RPS29B) ribo...    60   3e-10
At3g43980.1 68416.m04708 40S ribosomal protein S29 (RPS29A) ribo...    60   3e-10
At4g21710.1 68417.m03144 DNA-directed RNA polymerase II 135 kDa ...    31   0.16 
At4g13960.1 68417.m02159 F-box family protein contains F-box dom...    27   2.6  
At5g47520.1 68418.m05867 Ras-related GTP-binding protein, putati...    27   4.5  
At3g21450.1 68416.m02706 protein kinase family protein contains ...    26   6.0  
At1g73360.1 68414.m08491 homeobox-leucine zipper family protein ...    26   6.0  
At1g60380.1 68414.m06798 apical meristem formation protein-relat...    26   6.0  
At5g38386.1 68418.m04638 F-box family protein contains F-box dom...    26   7.9  
At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiqui...    26   7.9  
At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiqui...    26   7.9  
At1g67025.1 68414.m07621 hypothetical protein                          26   7.9  
At1g60370.1 68414.m06797 F-box family protein similar to hypothe...    26   7.9  

>At4g33865.1 68417.m04805 40S ribosomal protein S29 (RPS29C)
          Length = 56

 Score = 60.5 bits (140), Expect = 3e-10
 Identities = 25/34 (73%), Positives = 26/34 (76%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           CR C N HGLIRKYGLN CRQCFR  A +IGF K
Sbjct: 21  CRVCGNSHGLIRKYGLNCCRQCFRSNAKEIGFIK 54



 Score = 39.5 bits (88), Expect = 6e-04
 Identities = 13/19 (68%), Positives = 17/19 (89%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MGH+N+W SHP++YG GSR
Sbjct: 1   MGHSNVWNSHPKKYGPGSR 19


>At3g44010.1 68416.m04712 40S ribosomal protein S29 (RPS29B)
           ribosomal protein S29, rat, PIR:S30298
          Length = 56

 Score = 60.5 bits (140), Expect = 3e-10
 Identities = 25/34 (73%), Positives = 26/34 (76%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           CR C N HGLIRKYGLN CRQCFR  A +IGF K
Sbjct: 21  CRVCGNSHGLIRKYGLNCCRQCFRSNAKEIGFIK 54



 Score = 39.5 bits (88), Expect = 6e-04
 Identities = 13/19 (68%), Positives = 17/19 (89%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MGH+N+W SHP++YG GSR
Sbjct: 1   MGHSNVWNSHPKKYGPGSR 19


>At3g43980.1 68416.m04708 40S ribosomal protein S29 (RPS29A)
           ribosomal protein S29, rat, PIR:S30298
          Length = 56

 Score = 60.5 bits (140), Expect = 3e-10
 Identities = 25/34 (73%), Positives = 26/34 (76%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           CR C N HGLIRKYGLN CRQCFR  A +IGF K
Sbjct: 21  CRVCGNSHGLIRKYGLNCCRQCFRSNAKEIGFIK 54



 Score = 39.5 bits (88), Expect = 6e-04
 Identities = 13/19 (68%), Positives = 17/19 (89%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MGH+N+W SHP++YG GSR
Sbjct: 1   MGHSNVWNSHPKKYGPGSR 19


>At4g21710.1 68417.m03144 DNA-directed RNA polymerase II 135 kDa
            polypeptide / RNA polymerase II subunit 2 (RPB135) (RPB2)
            (RP140) identical to SP|P38420 DNA-directed RNA
            polymerase II 135 kDa polypeptide (EC 2.7.7.6) (RNA
            polymerase II subunit 2) {Arabidopsis thaliana}
          Length = 1188

 Score = 31.5 bits (68), Expect = 0.16
 Identities = 11/42 (26%), Positives = 24/42 (57%)
 Frame = +2

Query: 92   QIFGILTLADTDKDLGSCRSCSNRHGLIRKYGLNICRQCFRE 217
            ++ G++ +A+  K+   CR C N+  +++ Y    C+  F+E
Sbjct: 1125 EVCGLIAIANLKKNSFECRGCKNKTDIVQVYIPYACKLLFQE 1166


>At4g13960.1 68417.m02159 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 434

 Score = 27.5 bits (58), Expect = 2.6
 Identities = 11/37 (29%), Positives = 21/37 (56%)
 Frame = -3

Query: 201 LHMFKPYLRIKPCLLEQDRHXPRSLSVSARVRIPNIC 91
           +HM K ++   PCL+E + +     S   ++R+P +C
Sbjct: 367 MHMIKHFVNYFPCLMETNIYIEE--SGPPKLRVPQVC 401


>At5g47520.1 68418.m05867 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein RAB11J GI:1370160 from
           [Lotus japonicus]
          Length = 221

 Score = 26.6 bits (56), Expect = 4.5
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = -3

Query: 156 EQDRHXPRSLSVSARVRIPNICVAHFKKLNCC 61
           E ++  P SLS   +V IP+     FKK  CC
Sbjct: 188 ELNKQDPASLSNGKKVVIPSDGQGEFKKGGCC 219


>At3g21450.1 68416.m02706 protein kinase family protein contains
           eukaryotic protein kinase domain, INTERPRO:IPR000719
          Length = 270

 Score = 26.2 bits (55), Expect = 6.0
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = +1

Query: 106 SHPRRYGQGSRXMPILLQQAWLNPQVRF 189
           SH   Y    + MP+++++ W +PQ RF
Sbjct: 21  SHGTVYTGLIKDMPVVIKREWCSPQPRF 48


>At1g73360.1 68414.m08491 homeobox-leucine zipper family protein /
           lipid-binding START domain-containing protein
           protodermal factor2 (GI:14276060) [Arabidopsis
           thaliana]; similar to homeobox protein GI:1173621 from [
           Phalaenopsis sp.]
          Length = 722

 Score = 26.2 bits (55), Expect = 6.0
 Identities = 14/59 (23%), Positives = 24/59 (40%)
 Frame = +3

Query: 81  NGPRKYLVFSPSQIRTRISXHADPAPTGMA*SASTV*TYADSASESMLMT*DSRSWTKW 257
           N  R  +V   +++  R++ H  P P G    A+T     +S         D R+  +W
Sbjct: 503 NNTRSTVVSELNEVGIRVTAHKSPEPNGTVLCAATTFWLPNSPQNVFNFLKDERTRPQW 561


>At1g60380.1 68414.m06798 apical meristem formation protein-related
           contains similarity to CUC1 [Arabidopsis thaliana]
           gi|12060422|dbj|BAB20598 and NAM [Petunia x hybrida]
           gi|1279640|emb|CAA63101
          Length = 318

 Score = 26.2 bits (55), Expect = 6.0
 Identities = 8/15 (53%), Positives = 12/15 (80%)
 Frame = -1

Query: 203 VCICSNRTCGLSHAC 159
           +CI +NRTCG++  C
Sbjct: 223 ICIFANRTCGVTDKC 237


>At5g38386.1 68418.m04638 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 403

 Score = 25.8 bits (54), Expect = 7.9
 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 4/51 (7%)
 Frame = -3

Query: 201 LHMFKPYLRIKPCLLEQDRHXPRSLSVSARVR-IPNI---CVAHFKKLNCC 61
           +HM K +L   PCL E      +    + + R IP +    V H+ KL+ C
Sbjct: 345 MHMIKHFLDYLPCLKEMKISYMKKNDHTTQFRVIPQVIAEMVEHYNKLSNC 395


>At4g38600.2 68417.m05463 HECT-domain-containing protein /
           ubiquitin-transferase family protein similar to
           SP|Q14669Thyroid receptor interacting protein 12
           (TRIP12) {Homo sapiens}; contains Pfam profile PF00632:
           HECT-domain (ubiquitin-transferase)
          Length = 1794

 Score = 25.8 bits (54), Expect = 7.9
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = -3

Query: 144 HXPRSLSVSARVRIPNICVAHFKKLNCCFANEQQN*RQH 28
           H  RSLS SAR+      +AH  KL  C A+ ++  R +
Sbjct: 829 HPSRSLSGSARLSSGLSALAHPLKLRLCRASGEKTLRDY 867


>At4g38600.1 68417.m05464 HECT-domain-containing protein /
            ubiquitin-transferase family protein similar to
            SP|Q14669Thyroid receptor interacting protein 12 (TRIP12)
            {Homo sapiens}; contains Pfam profile PF00632:
            HECT-domain (ubiquitin-transferase)
          Length = 1888

 Score = 25.8 bits (54), Expect = 7.9
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = -3

Query: 144  HXPRSLSVSARVRIPNICVAHFKKLNCCFANEQQN*RQH 28
            H  RSLS SAR+      +AH  KL  C A+ ++  R +
Sbjct: 902  HPSRSLSGSARLSSGLSALAHPLKLRLCRASGEKTLRDY 940


>At1g67025.1 68414.m07621 hypothetical protein
          Length = 221

 Score = 25.8 bits (54), Expect = 7.9
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = +2

Query: 128 KDLGSCRSCSNRHGLIRKYGLNICRQC 208
           +D  SCR CSN HG+     ++   QC
Sbjct: 179 RDDQSCRGCSNSHGVCGSEPVSGSFQC 205


>At1g60370.1 68414.m06797 F-box family protein similar to
           hypothetical protein GI:9993352 from [Arabidopsis
           thaliana]
          Length = 283

 Score = 25.8 bits (54), Expect = 7.9
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = +2

Query: 104 ILTLADTDKDLGSCRSCSNRHGLIRKYGLNI 196
           ILTL  T+K LG    CS  H ++   G+ I
Sbjct: 178 ILTLGTTEKMLGRKIECSLTHNILSNEGVCI 208


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,591,234
Number of Sequences: 28952
Number of extensions: 100893
Number of successful extensions: 205
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 202
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 205
length of database: 12,070,560
effective HSP length: 72
effective length of database: 9,986,016
effective search space used: 429398688
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -