SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B01
         (653 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g63780.1 68418.m08005 zinc finger (C3HC4-type RING finger) fa...    30   1.5  
At5g08750.1 68418.m01039 zinc finger (C3HC4-type RING finger) fa...    30   1.5  
At1g30550.1 68414.m03737 expressed protein similar to PIMT (GI:1...    28   6.2  

>At5g63780.1 68418.m08005 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 367

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = +3

Query: 33  RYWNIIFYFWYLIRNNW 83
           RYW I+F FW+L+   W
Sbjct: 340 RYWAILFIFWFLVFGIW 356


>At5g08750.1 68418.m01039 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 363

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = +3

Query: 33  RYWNIIFYFWYLIRNNW 83
           RYW I+F FW+L+   W
Sbjct: 336 RYWAILFVFWFLVFGIW 352


>At1g30550.1 68414.m03737 expressed protein similar to PIMT
           (GI:15127914) [Mus musculus]; similar to hypothetical
           protein GB:AAF19758 GI:6634778 from [Arabidopsis
           thaliana]
          Length = 391

 Score = 27.9 bits (59), Expect = 6.2
 Identities = 16/42 (38%), Positives = 25/42 (59%)
 Frame = -1

Query: 344 ILLEINNIREGGRSQNLILFIRGNAISGAPSIRGTNQFPNPP 219
           I L +NN +  G + N I F+ G+ +  APS++G   F +PP
Sbjct: 82  IALAMNNAKVYGVA-NRIDFVTGDFMQLAPSLKGDVLFLSPP 122


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,069,568
Number of Sequences: 28952
Number of extensions: 165790
Number of successful extensions: 299
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 296
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 299
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1363910256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -