SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A24
         (653 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g65360.1 68418.m08221 histone H3 identical to histone H3 from...   103   1e-22
At5g10400.1 68418.m01206 histone H3 identical to several histone...   103   1e-22
At5g10390.1 68418.m01205 histone H3 identical to histone H3 from...   103   1e-22
At3g27360.1 68416.m03421 histone H3 identical to histone H3 from...   103   1e-22
At1g09200.1 68414.m01027 histone H3 identical to histone H3 from...   103   1e-22
At5g65350.1 68418.m08220 histone H3 nearly identical to histone ...   101   4e-22
At5g10980.1 68418.m01277 histone H3 identical to HISTONE H3.2, M...   100   7e-22
At4g40040.1 68417.m05668 histone H3.2 identical to Histone H3.2,...   100   7e-22
At4g40030.1 68417.m05667 histone H3.2 identical to Histone H3.2,...   100   7e-22
At1g75600.1 68414.m08784 histone H3.2, putative strong similarit...   100   2e-21
At1g13370.1 68414.m01554 histone H3, putative strong similarity ...    98   5e-21
At1g19890.1 68414.m02494 histone H3, putative similar to histone...    97   7e-21
At5g12910.1 68418.m01481 histone H3, putative similar to histone...    87   7e-18
At1g01370.1 68414.m00052 centromeric histone H3 HTR12 (HTR12) si...    50   2e-06
At3g10380.1 68416.m01244 exocyst complex component-related ident...    29   2.0  
At2g33670.1 68415.m04126 seven transmembrane MLO family protein ...    28   4.7  
At2g19940.2 68415.m02331 semialdehyde dehydrogenase family prote...    28   4.7  
At2g19940.1 68415.m02330 semialdehyde dehydrogenase family prote...    28   4.7  
At2g44210.1 68415.m05502 expressed protein  Pfam profile PF03080...    28   6.2  

>At5g65360.1 68418.m08221 histone H3 identical to histone H3 from
           Zea mays SP|P05203, Medicago sativa GI:166384,
           Encephalartos altensteinii SP|P08903, Pisum sativum
           SP|P02300; contains Pfam profile PF00125 Core histone
           H2A/H2B/H3/H4
          Length = 136

 Score =  103 bits (247), Expect = 1e-22
 Identities = 51/59 (86%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 6e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>At5g10400.1 68418.m01206 histone H3 identical to several histone H3
           proteins, including Zea mays SP|P05203, Medicago sativa
           GI:166384, Encephalartos altensteinii SP|P08903, Pisum
           sativum SP|P02300; contains Pfam profile PF00125 Core
           histone H2A/H2B/H3/H4
          Length = 136

 Score =  103 bits (247), Expect = 1e-22
 Identities = 51/59 (86%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 6e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>At5g10390.1 68418.m01205 histone H3 identical to histone H3 from
           Zea mays SP|P05203, Medicago sativa GI:166384,
           Encephalartos altensteinii SP|P08903, Pisum sativum
           SP|P02300; contains Pfam profile PF00125 Core histone
           H2A/H2B/H3/H4
          Length = 136

 Score =  103 bits (247), Expect = 1e-22
 Identities = 51/59 (86%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 6e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>At3g27360.1 68416.m03421 histone H3 identical to histone H3 from
           Zea mays SP|P05203, Medicago sativa GI:166384,
           Encephalartos altensteinii SP|P08903, Pisum sativum
           SP|P02300; contains Pfam profile PF00125 Core histone
           H2A/H2B/H3/H4
          Length = 136

 Score =  103 bits (247), Expect = 1e-22
 Identities = 51/59 (86%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 6e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>At1g09200.1 68414.m01027 histone H3 identical to histone H3 from
           Zea mays SP|P05203, Medicago sativa GI:166384,
           Encephalartos altensteinii SP|P08903, Pisum sativum
           SP|P02300; contains Pfam profile PF00125 Core histone
           H2A/H2B/H3/H4
          Length = 136

 Score =  103 bits (247), Expect = 1e-22
 Identities = 51/59 (86%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 6e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>At5g65350.1 68418.m08220 histone H3 nearly identical to histone H3
           from Zea mays SP|P05203, Medicago sativa GI:166384,
           Encephalartos altensteinii SP|P08903, Pisum sativum
           SP|P02300; contains Pfam profile PF00125 Core histone
           H2A/H2B/H3/H4
          Length = 139

 Score =  101 bits (242), Expect = 4e-22
 Identities = 49/59 (83%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALR+IR+YQKSTE+LIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALRDIRKYQKSTEILIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGL 104



 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 40/45 (88%), Positives = 43/45 (95%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTAR STGGKAPRKQLA KAAR+SAP+TGGVKKPHR+RPG
Sbjct: 1   MARTKQTARISTGGKAPRKQLAPKAARQSAPATGGVKKPHRFRPG 45



 Score = 72.1 bits (169), Expect = 3e-13
 Identities = 33/34 (97%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPK+IQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKEIQLARRIRGERA 136


>At5g10980.1 68418.m01277 histone H3 identical to HISTONE H3.2,
           MINOR, Medicago sativa, SWISSPROT:P11105, histone H3
           variant H3.3 Lycopersicon esculentum GI:1435157;
           contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4
          Length = 136

 Score =  100 bits (240), Expect = 7e-22
 Identities = 51/59 (86%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDL FQS A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGL 104



 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>At4g40040.1 68417.m05668 histone H3.2 identical to Histone H3.2,
           minor Lolium temulentum SP|P11105, nearly identical to
           histone H3.2 Mus pahari GI:515005; contains Pfam profile
           PF00125 Core histone H2A/H2B/H3/H4
          Length = 136

 Score =  100 bits (240), Expect = 7e-22
 Identities = 51/59 (86%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDL FQS A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGL 104



 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>At4g40030.1 68417.m05667 histone H3.2 identical to Histone H3.2,
           minor Lolium temulentum SP|P11105, nearly identical to
           histone H3.2 Mus pahari GI:515005; contains Pfam profile
           PF00125 Core histone H2A/H2B/H3/H4
          Length = 136

 Score =  100 bits (240), Expect = 7e-22
 Identities = 51/59 (86%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDL FQS A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGL 104



 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>At1g75600.1 68414.m08784 histone H3.2, putative strong similarity
           to histone H3.2 SP|P11105 GI:417103 from Lolium
           temulentum, histone H3.2 from Mus pahari GI:515005;
           contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4
          Length = 136

 Score = 99.5 bits (237), Expect = 2e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELLIRKLPFQRLVREIAQD+KTDL FQS A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRKYQKSTELLIRKLPFQRLVREIAQDYKTDLRFQSHAVLALQEAAEAYLVGL 104



 Score = 87.8 bits (208), Expect = 6e-18
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKS GGKAPR  LATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSHGGKAPRTLLATKAARKSAPTTGGVKKPHRYRPG 45



 Score = 73.3 bits (172), Expect = 1e-13
 Identities = 33/34 (97%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKD+QLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDVQLARRIRGERA 136


>At1g13370.1 68414.m01554 histone H3, putative strong similarity to
           Histone H3.2, minor Medicago sativa SP|P11105, histone
           H3 Rubus idaeus GI:10732809; contains Pfam profile
           PF00125 Core histone H2A/H2B/H3/H4
          Length = 136

 Score = 97.9 bits (233), Expect = 5e-21
 Identities = 50/59 (84%), Positives = 53/59 (89%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELL RKLPFQRLVREIAQDFKTDL FQS A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRKYQKSTELLNRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGL 104



 Score = 87.4 bits (207), Expect = 7e-18
 Identities = 40/45 (88%), Positives = 43/45 (95%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQ+ARKS GGKAP KQLATKAARKSAP+TGGVKKPHR+RPG
Sbjct: 1   MARTKQSARKSHGGKAPTKQLATKAARKSAPTTGGVKKPHRFRPG 45



 Score = 70.9 bits (166), Expect = 7e-13
 Identities = 32/34 (94%), Positives = 33/34 (97%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKD+QLARRIR ERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDVQLARRIRAERA 136


>At1g19890.1 68414.m02494 histone H3, putative similar to histone H3
           from Chlamydomonas reinhardtii GI:571470, Volvox carteri
           SP|P08437, histone H3.2 minor from Lolium temulentum
           SP|P11105; contains Pfam profile PF00125 Core histone
           H2A/H2B/H3/H4
          Length = 137

 Score = 97.5 bits (232), Expect = 7e-21
 Identities = 49/59 (83%), Positives = 53/59 (89%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKST+LLIRKLPFQRLVREIAQDFK DL FQS A+ ALQEA+EAYL  L
Sbjct: 47  TVALREIRKYQKSTDLLIRKLPFQRLVREIAQDFKVDLRFQSHAVLALQEAAEAYLVGL 105



 Score = 75.8 bits (178), Expect = 2e-14
 Identities = 36/46 (78%), Positives = 40/46 (86%), Gaps = 1/46 (2%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKS-APSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGK PRK+LATKAARK+  P  GGVK+ HR+RPG
Sbjct: 1   MARTKQTARKSTGGKGPRKELATKAARKTRRPYRGGVKRAHRFRPG 46



 Score = 70.5 bits (165), Expect = 9e-13
 Identities = 33/34 (97%), Positives = 33/34 (97%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIM KDIQLARRIRGERA
Sbjct: 104 GLFEDTNLCAIHAKRVTIMSKDIQLARRIRGERA 137


>At5g12910.1 68418.m01481 histone H3, putative similar to histone H3
           from Mus musculus GI:51301, Gallus gallus GI:211859,
           Medicago sativa GI:166384, Pisum sativum SP|P02300;
           contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4
          Length = 131

 Score = 87.4 bits (207), Expect = 7e-18
 Identities = 40/56 (71%), Positives = 50/56 (89%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYL 426
           TVALREIR+YQK+T+L+IRKLPFQRLV+EIAQ  K DL FQ+ A+ ALQEA+EA++
Sbjct: 41  TVALREIRKYQKTTDLVIRKLPFQRLVKEIAQSLKADLRFQTGAVSALQEAAEAFM 96



 Score = 64.9 bits (151), Expect = 4e-11
 Identities = 28/39 (71%), Positives = 33/39 (84%)
 Frame = +2

Query: 413 ARLISXGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 529
           A     G+FEDTNLCA+HAKR TIMPKDIQLA+R+RG+R
Sbjct: 92  AEAFMVGMFEDTNLCAMHAKRSTIMPKDIQLAKRLRGDR 130



 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 24/45 (53%), Positives = 31/45 (68%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MAR+ QTARK+TGGKAP    A +  + S P    +KKP+RY+PG
Sbjct: 1   MARSNQTARKATGGKAP--HFAMRVWQHSTPP---LKKPYRYKPG 40


>At1g01370.1 68414.m00052 centromeric histone H3 HTR12 (HTR12)
           similar to histone H3 GB:X17141 GI:10795 from
           Tetrahymena pyriformis, GI:161790 from Tetrahymena
           thermophila; contains Pfam profile PF00125 Core histone
           H2A/H2B/H3/H4
          Length = 178

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 21/32 (65%), Positives = 27/32 (84%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 526
           GLF D+ LCAIHA+RVT+M KD +LARR+ G+
Sbjct: 143 GLFSDSMLCAIHARRVTLMRKDFELARRLGGK 174



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 28/61 (45%), Positives = 34/61 (55%), Gaps = 2/61 (3%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL--XFQSAAIGALQEASEAYLXW 432
           TVAL+EIR +QK T LLI    F R VR I           + + A+ ALQEA+E YL  
Sbjct: 84  TVALKEIRHFQKQTNLLIPAASFIREVRSITHMLAPPQINRWTAEALVALQEAAEDYLVG 143

Query: 433 L 435
           L
Sbjct: 144 L 144


>At3g10380.1 68416.m01244 exocyst complex component-related
           identical to Probable exocyst complex component Sec8
           (Swiss-Prot:Q93YU5) [Arabidopsis thaliana]; weak
           similarity to Exocyst complex component Sec8 (rSec8)
           (Swiss-Prot:Q62824) [Rattus norvegicus]
          Length = 1053

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 13/23 (56%), Positives = 15/23 (65%)
 Frame = -3

Query: 291 LITTNFTKGHCXQGDNDVAS*LH 223
           L TTN +K  C QGD  VA+ LH
Sbjct: 378 LETTNLSKSACSQGDRSVAAGLH 400


>At2g33670.1 68415.m04126 seven transmembrane MLO family protein /
           MLO-like protein 5 (MLO5) identical to MLO-like protein
           5 (AtMlo5) [Arabidopsis thaliana] SWISS-PROT:O22815;
           similar to MLO protein SWISS-PROT:P93766,
           NCBI_gi:1877221 [Hordeum vulgare][Barley]
          Length = 501

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 11/30 (36%), Positives = 17/30 (56%)
 Frame = -2

Query: 187 ASCLRGALPPVDLRAVCLVRAIVYFFNVFH 98
           A C +G +P + L A+  V   ++F  VFH
Sbjct: 132 AQCKKGYVPLISLNALHQVHIFIFFLAVFH 161


>At2g19940.2 68415.m02331 semialdehyde dehydrogenase family protein
           similar to N-acetyl-glutamyl-phosphate reductase
           [Campylobacter jejuni] GI:6650362; contains Pfam
           profiles PF02774: Semialdehyde dehydrogenase
           dimerisation domain, PF01118: Semialdehyde dehydrogenase
           NAD binding domain
          Length = 359

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 17/40 (42%), Positives = 24/40 (60%)
 Frame = +3

Query: 372 AFPVCRHRSSPGGKRGLSRLACSKTPTCVLFTPNV*PSCR 491
           ++ V RHR  P  ++GLS +A SK    V FTP++ P  R
Sbjct: 216 SYGVTRHRHVPEIEQGLSDVAQSK--VTVSFTPHLMPMIR 253


>At2g19940.1 68415.m02330 semialdehyde dehydrogenase family protein
           similar to N-acetyl-glutamyl-phosphate reductase
           [Campylobacter jejuni] GI:6650362; contains Pfam
           profiles PF02774: Semialdehyde dehydrogenase
           dimerisation domain, PF01118: Semialdehyde dehydrogenase
           NAD binding domain
          Length = 359

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 17/40 (42%), Positives = 24/40 (60%)
 Frame = +3

Query: 372 AFPVCRHRSSPGGKRGLSRLACSKTPTCVLFTPNV*PSCR 491
           ++ V RHR  P  ++GLS +A SK    V FTP++ P  R
Sbjct: 216 SYGVTRHRHVPEIEQGLSDVAQSK--VTVSFTPHLMPMIR 253


>At2g44210.1 68415.m05502 expressed protein  Pfam profile PF03080:
           Arabidopsis proteins of unknown function
          Length = 415

 Score = 27.9 bits (59), Expect = 6.2
 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 1/46 (2%)
 Frame = -2

Query: 574 YRITSNQNYN*TNLSTFTTDSSSKL-NILRHDGHTFGVNSTQVGVF 440
           YR +S +NY   N  +     SS+  N+L  +GH   +   + GVF
Sbjct: 133 YRASSVENYGMKNQKSIPKPKSSEPPNVLTQNGHQHAIMYVEDGVF 178


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,520,252
Number of Sequences: 28952
Number of extensions: 203172
Number of successful extensions: 537
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 499
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 535
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1363910256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -